KEGG   Schizosaccharomyces pombe (fission yeast): SPAC19G12.06c
Entry
SPAC19G12.06c     CDS       T00076                                 

Gene name
hta2
Definition
(RefSeq) histone H2A beta
  KO
K11251  histone H2A
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC19G12.06c (hta2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC19G12.06c (hta2)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    SPAC19G12.06c (hta2)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPAC19G12.06c (hta2)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 2542226
NCBI-ProteinID: NP_594421
PomBase: SPAC19G12.06c
UniProt: P04910
Position
I:complement(4052852..4053247)
AA seq 131 aa
MSGGKSGGKAAVAKSAQSRSAKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYL
AAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGHVTIAQGGVVPNINAHLLPK
QSGKGKPSQEL
NT seq 396 nt   +upstreamnt  +downstreamnt
atgtctggaggtaaatctggtggtaaggccgcagtcgccaagtctgctcaatctcgttcc
gctaaggctggtttggccttccctgtcggtcgtgttcatcgtttgttgcgtaagggtaat
tatgctcaacgtgttggtgctggtgctcccgtttacttggctgccgtcttggagtattta
gctgccgaaatcctcgaattggccggtaatgctgctcgtgataacaagaagactcgtatc
attccccgtcatcttcaattggctattcgcaatgacgaagaattgaacaaactacttggt
catgttactattgcccagggtggtgttgtacctaatatcaacgctcatctcttgcccaaa
caatctggtaagggcaagcctagccaagagctttaa

DBGET integrated database retrieval system