KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1A6.04c
Entry
SPAC1A6.04c       CDS       T00076                                 

Symbol
plb1
Name
(RefSeq) lysophospholipase 1
  KO
K13333  lysophospholipase [EC:3.1.1.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPAC1A6.04c (plb1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SPAC1A6.04c (plb1)
SSDB
Motif
Pfam: PLA2_B DAN LIM
Other DBs
NCBI-GeneID: 2542497
NCBI-ProteinID: NP_593196
PomBase: SPAC1A6.04c
UniProt: P78854
Position
I:complement(1074777..1076618)
AA seq 613 aa
MLFRGLSLWMLFLASCLSALALPAAEDDGSVKVFKRAKKHSTKQEGPSYAPYYVDCPSDN
IVESLSSNEIPSAESEYLSTRSTITNTAMKDFLRNANLPGLNADTLSGSEGPSIGIALSG
GGLRAMILGSGALSAMDARHDNHTVLTGLLQASDYLVGTDGSAWTVGGIALNNFSTINDF
SKLWAFNHPLMYPKSAIVFNAHFYSSIMNEVAEKANAGFNISLSDYWGRVISRTLGDTTY
GFPNVSLSSITSQEWYRNANFPYPIITFATQNYGEDISNVNTTFFEASPNVFGTFDHGIN
SFIPTEYLGTTLNNGASSNGSCVINYDNFGFMMGASSTYFNKIMRNFNDSSTKNGRIIQQ
YLKGNFSENGQQIISIPNPFQGVESANSDAANNLGSSSSLNLVDTFLTGEKIPLWPLLQK
GRDVDVIVAVDNGDDSEWLWPNGNSLVQTYERVVAAQAAGNTNVKGFPYVPSQQSFVSLH
FNDRPVFFGCDGRNTTAGNHTVTRDTPPLVIYLPNVPYNYFTNISTDRTYYTEDMIQQLL
TNGLISSTVDNDTYFGQCFACAVVKRTLERNNITASPECQQCYYNYCWSGLYDDSAANDD
IVYNPTCRLGEGI
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgcttttccgcggattaagcctgtggatgctctttttggcatcctgcctttctgccctt
gctcttcccgctgctgaagacgatggttctgtcaaggtcttcaagcgtgccaagaagcat
agcactaagcaagagggacccagttacgctccttattatgtggactgtccctctgataac
attgtcgagagtctctccagcaatgagattcctagcgccgagtctgaatacttgagcact
cgttctactattaccaacactgccatgaaggacttccttcgtaacgccaacttgcctggt
ttgaatgccgatactctttctggctctgaaggtccttctatcggtattgccttgtccggt
ggtggtttacgtgccatgattttgggttctggtgccctctctgccatggatgctcgtcac
gacaaccacactgttttgactggtctccttcaagcctctgactatctcgttggtactgat
ggtagtgcctggactgttggtggcattgctctcaacaatttcagtaccattaacgacttt
agcaaactttgggctttcaaccaccctttgatgtatcccaagagtgctattgttttcaac
gctcatttctacagttctattatgaatgaagttgccgaaaaggccaatgctggctttaac
atcagtctttccgattactggggacgtgtgatttctcgtacccttggtgacactacttat
ggtttccctaatgtctctttgtctagtattacttcccaagaatggtaccgcaatgccaac
ttcccttaccccatcattacctttgctacccaaaactatggtgaggatattagcaatgtt
aacactactttctttgaagcttcccccaacgttttcggtacctttgaccatggaatcaac
tcctttattcctaccgaatacttgggtactaccttaaacaatggtgctagcagcaatggt
tcttgcgttatcaactatgacaactttggtttcatgatgggtgcttcttctacttacttc
aacaagataatgcgtaacttcaatgactcttctaccaagaacggtcgtatcatccaacaa
tacttgaaaggtaacttttctgaaaacggtcaacaaatcatctccattcccaaccccttc
caaggtgttgagagtgctaattctgatgctgccaacaacttgggttccagctcttccctt
aacttagttgataccttccttactggtgagaagattcctttgtggcctttgttgcaaaag
ggtcgtgatgtcgatgttatcgttgccgttgacaatggtgatgacagtgaatggctctgg
cccaacggtaactctcttgtccaaacttatgagcgtgtcgttgctgcccaagctgccgga
aacaccaatgttaagggtttcccctacgttcctagccaacaatcctttgtcagtcttcac
ttcaacgatcgccctgtcttctttggttgtgatggtcgtaacaccactgctggtaaccac
actgttacccgtgacactcctcctttggttatctatcttcccaacgttccttacaactac
ttcactaacatttccactgatcgcacctactacactgaagacatgattcaacaacttctt
accaacggccttatttcctctaccgttgacaatgacacctactttggtcaatgttttgcc
tgtgccgttgttaagcgtactttggagcgtaacaacatcactgctagccccgagtgccaa
caatgctactataactactgctggagcggtctttatgatgacagcgctgctaatgatgat
attgtctacaatcctacttgccgtcttggtgaaggcatttaa

DBGET integrated database retrieval system