KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1B3.03c
Entry
SPAC1B3.03c       CDS       T00076                                 

Gene name
wis2
Definition
(RefSeq) cyclophilin family peptidyl-prolyl cis-trans isomerase Wis2
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPAC1B3.03c (wis2)
Enzymes [BR:spo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SPAC1B3.03c (wis2)
Chaperones and folding catalysts [BR:spo03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    SPAC1B3.03c (wis2)
SSDB
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_12 TPR_16 TPR_8 TPR_11
Other DBs
NCBI-GeneID: 2542541
NCBI-ProteinID: NP_594787
PomBase: SPAC1B3.03c
UniProt: Q11004
Position
I:complement(4929945..4931015)
AA seq 356 aa
MSTYAYFKISIDGKIQPTIYFELFDNVVPKTVKNFASLCNGFEKDGRCLTYKGSRFHRVI
KNFMLQGGDFTRGNGTGGESIYGEKFEDENFELKHDKPFLLSMANAGPNTNGSQFFITTV
PTPHLDGKHVVFGKVIQGKSTVRTIENLETKNDDPVVPVVIEECGTCTKDQIEAPKPDVT
GDSLEEFPDDYEGDKSETAIFKIASDLKGIANKQFAQQNLDTAVAKWQKALRYLMEYPVP
NDDSKESPDFWKEYNALRYSIYANLALVALKQNKPQEAIRNANIVIEASNSTELEKQKAY
YRLGCAQGLLKNFEESEKALAKAGNDPAISKKLAEIRQKKKDYKKRQQKAYAKMFQ
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagtacttacgcctattttaaaattagcattgatggtaaaattcaaccaacaatctac
tttgaacttttcgacaacgtagttcccaaaactgtcaaaaactttgcttcgttgtgtaat
gggtttgagaaggatggccgttgtttaacctacaaaggttcaaggttccatcgagtaatt
aagaactttatgcttcaaggtggtgactttactcgtggtaatggaacgggtggagaaagc
atctacggcgagaagtttgaggacgagaactttgagctcaagcatgataagcctttcttg
ctttccatggccaatgccggccctaataccaatggatctcagttcttcattactactgtt
cccacccctcatttggatggaaagcatgttgtttttggcaaggtaattcaaggaaaatct
actgttcgtaccattgaaaatttggagaccaaaaatgacgatccggttgtacctgttgtt
attgaagaatgtggaacttgcacaaaggatcagattgaggcaccaaagccagacgttact
ggtgattctctggaagaatttcctgatgattacgagggtgataagtccgagactgccatt
ttcaaaattgctagcgacttaaagggaattgctaacaagcaatttgctcagcaaaatttg
gatacagccgttgccaaatggcaaaaagctttgcgctacctaatggaataccctgttccc
aacgatgactctaaggaatcccctgatttctggaaagagtataatgctttacgatacagc
atatacgcaaaccttgcccttgtagctttgaagcagaacaaacctcaggaagctattcga
aacgccaacattgtaattgaggccagtaactctactgagttagagaaacagaaagcatac
tatcgtttgggttgtgctcaaggtctcttgaagaattttgaagaatcagagaaagcactt
gctaaggctggtaacgatcctgcaatttcaaagaagcttgcagaaattcgtcaaaagaaa
aaagattataagaagcgccaacaaaaggcctatgctaagatgtttcagtaa

DBGET integrated database retrieval system