KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1B3.16c
Entry
SPAC1B3.16c       CDS       T00076                                 
Symbol
vht1
Name
(RefSeq) vitamin H transporter Vth1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 2542518
NCBI-ProteinID: NP_594801
PomBase: SPAC1B3.16c
UniProt: O13880
Position
I:complement(4959094..4960800)
AA seq 568 aa
MASEWPETSRASSVEENPKLNIPEIVESVSDSKPSLKNQFSTTVIDSSDLNVFNDGAETT
VKEQEFTSSELRRLQKLRLKMDLRIIPCLWILYFLSCCLRFTVSLSFTMNTAQGHSLIQT
LSGYSAHYLALGLALFYVGYIIFEVPSNLMMAFIEPRIWVSRIQLTIGVVGACHAVLGTK
HGNAQSYVALRFFLGVAESGLWPGLAYYMSRWYRGKHLGKRIGWYYTAAQIAAAAVSLVS
AGFQKMDGARGLYGYQWMFLIWGVVAIAQALSIPWWLPAVASKEHRKSLSSFIPLPKWMK
TLSPQRIGFLTPADKSLHSRYIAEMNVGKRWQWSDLLKSCLDLRVWPFILMYFGIVGVGN
GIFNYCTLIIEEINPSFSGIDISLLNAPIWLADALGIVTVMPLYDRFHKKFSFFTGSCLI
IIAGLAVANYAPRAWSRYGGLLMIGFGLGPTVPICMAWCSASMAKTYGDVGVASSLALVT
GLGNLGSVVTTYALYSGWPGDPTFRKSNDVCIALIGVSIIACGIEFLLDKTGFGQFNASF
NNHDHEVEDEQEMTDIKPALPSSQQADA
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggcttcagaatggcctgaaacatcgagggcctcctcagttgaggagaatcccaaactt
aatattcctgaaattgtcgaaagcgtatcagattcaaagccctcattgaagaatcaattt
tcgacgacagtaatcgattcgtctgatctcaatgtttttaacgatggtgcggaaacgacg
gtaaaagagcaagaatttactagtagcgaattgcgaaggttacagaaattaagattgaaa
atggaccttcgtatcattccatgtctttggattctttactttttgtcttgttgtcttcgt
tttactgtctcactttcgtttaccatgaatacggctcagggccacagtcttattcaaaca
ctttctggctactcagctcactatctcgccttgggtttggcgttgttttacgttggctac
attatttttgaggtgccctccaacttgatgatggcatttatcgagccccgaatttgggtg
tctcgtatccaactcaccattggtgttgttggtgcttgccatgcagttttgggaacgaaa
catggtaatgcgcaaagttatgtcgctttacgtttcttcttaggtgtcgctgaatccggc
ttatggcccggcttggcttactacatgagccgttggtataggggcaagcacttgggtaaa
cgtattggttggtattatacggctgctcaaattgcagcagcagccgtcagtttggtttca
gctggtttccaaaagatggatggcgctcgcggcttgtatggataccagtggatgttcctt
atctggggagtcgttgctattgcccaagcattatccattccctggtggttgccggcagtt
gcttcaaaggagcatagaaagtcgcttagctcgtttattcccttacccaaatggatgaaa
actttgtctcctcagagaattggcttcctcacgcctgccgacaaatcccttcattctaga
tacattgcagagatgaatgttggtaagcggtggcaatggtctgatttgctaaagtcttgc
ttggatctccgcgtatggccttttattctcatgtactttggtatcgtcggtgtgggtaat
ggtatcttcaactattgtactttgattattgaagagattaaccccagtttttccggtatc
gatatctcgttgttgaatgctcctatttggcttgccgacgctttgggcattgtcactgtt
atgccattgtacgacagattccataagaagttttccttcttcacgggatcctgtttgatc
atcatcgccggccttgccgttgctaactacgctcctcgtgcctggtcacgctatggtggt
ttactcatgattggatttggtcttggtccaaccgttcccatttgtatggcctggtgctcc
gcctccatggccaaaacctatggcgatgtaggcgtggcttccagcttggccctcgtgacg
ggtttgggcaatttgggatctgtcgttacgacatatgctctttacagtggctggcctggt
gatcctaccttccgtaaaagtaatgatgtctgcattgcattgatcggtgtctccataata
gcgtgtggtattgaatttttgctggataagactggattcggtcaattcaacgctagtttt
aacaaccatgatcatgaggtggaagacgagcaagagatgaccgatattaagcccgcgctt
ccttcttcccaacaggctgacgcttga

DBGET integrated database retrieval system