KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1B9.02c
Entry
SPAC1B9.02c       CDS       T00076                                 

Gene name
sck1
Definition
(RefSeq) serine/threonine protein kinase Sck1
  KO
K19800  serine/threonine protein kinase SCH9 [EC:2.7.11.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    SPAC1B9.02c (sck1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPAC1B9.02c (sck1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPAC1B9.02c (sck1)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   SPAC1B9.02c (sck1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like C2 Pkinase_fungal APH Kdo DVL
Other DBs
NCBI-GeneID: 2542492
NCBI-ProteinID: NP_593754
PomBase: SPAC1B9.02c
UniProt: P50530
Position
I:complement(join(2402301..2402493,2402544..2403510,2403560..2404250,2404367..2404606))
AA seq 696 aa
MTEIFGKLHRSSNSENTNQASPSTIQSHSTQPVLSNDHSTKVNDYEGKEGASSNGYDPVF
MSDRMKMRYNEITAQLHKEQSLKEDKESGSNSSESNGITPMGTYSEKPKLLQSRTPPSSC
YIRHDTVVPKDKNGQHAFGRLYVRLHQGRDLNVKSVNAQPYAVITFEKTQVMVPPPFKDI
DGGIPISIPSKNRPLAGSASGSSSGLHSELMLADVRCPHWDFETVFDVTKMKSQMVVSVY
DKYEDDKFLGSVKITPIFLHEYVQEAWYKLEPLDLTKSLEGEIKVETIYEHIEHVRYGPE
DFTALRLIGKGTFGQVYLVRKNDTNRIYAMKKISKKLIVRKKEVTHTLGERNILVRTSLD
ESPFIVGLKFSFQTASDLYLITDYMSGGELFWHLQHEGRFPEQRAKFYIAELVLALEHLH
KHDIIYRDLKPENILLDADGHIALCDFGLSKANLSANATTNTFCGTTEYLAPEVLLEDKG
YTKQVDFWSLGVLVFEMCCGWSPFYAPDVQQMYRNIAFGKVRFPKGVLSSEGRSFVRGLL
NRNPNHRLGAVADTTELKEHPFFADINWDLLSKKKVQPPFKPNVQNDLDVSNFDKEFTNT
NVKNINIVSNVDPANASTPLSNTIQDRFRGFTFVNKSIDEQFQNLGLQENEETDNLHACR
TTTHSSVNSINSHGNPRTVDANDPVADTVFGETFEA
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgaccgaaattttcggtaaattgcatcgatcatcaaattctgagaatacaaatcaagca
tcgccatccacaatacaatcgcattcaacgcaaccggttctttccaatgaccattctacg
aaagtaaacgattacgaagggaaagagggtgcttcgtctaatggctatgatcccgttttc
atgtcggatcggatgaagatgcgttacaatgagattacagctcagcttcacaaagaacag
tccttaaaggaagataaagaatctggttctaatagttccgaaagcaatggaattacacca
atgggtacatattcagaaaaacccaaactactacagagtcgtacacctccatcttcgtgt
tacattaggcatgataccgttgtgccaaaagataaaaatggtcagcatgcttttggacgg
ctttatgttcgattacatcaaggtagagatttgaacgtcaaaagtgttaatgcacaacct
tatgcagtaatcacctttgaaaaaacgcaggttatggtacctcctccttttaaagacatt
gacggtgggatacccatttccattccttctaaaaaccgtcctcttgctggatctgcttcc
ggttcttcttctggactacattctgagctaatgttggctgatgtgcgttgtcctcattgg
gattttgaaactgtatttgatgtgacaaaaatgaaaagtcaaatggttgtatctgtatat
gacaaatatgaagacgataaatttttgggctccgttaaaattacaccaattttcctacat
gaatatgtgcaggaagcatggtataagcttgagcctcttgacttaactaagtctctggag
ggtgaaataaaagtggaaacaatttacgagcacattgaacatgttcgttatgggccagaa
gattttacggcccttcgtttaatcggaaaaggcacttttgggcaagtttatttggtccgt
aaaaacgataccaatcggatttatgctatgaaaaagatatccaaaaaattaattgttcgt
aaaaaagaggttacacataccttgggcgaaaggaatatacttgtcaggacttcattagac
gaatctccgtttattgttggtttaaagttttcctttcagaccgcttcagatctttatttg
ataactgattatatgagtggaggcgaacttttctggcatcttcaacatgaaggtcgcttt
cctgagcaaagagctaaattttatatagccgaacttgttttggctcttgaacatttgcat
aaacatgatattatttaccgagatttaaagcctgaaaacatactattagatgcagatggt
catattgctctttgcgattttggtttgtctaaggcaaacctttcagctaacgcaactact
aataccttttgtggaaccaccgaatatttggcacctgaagttttacttgaggacaagggg
tatactaaacaggtcgatttctggtctttaggagtccttgtctttgagatgtgctgcgga
tggagccccttttatgctccagacgtccaacaaatgtatcgtaatattgcctttggaaag
gtccgttttccaaaaggagttctttcatcagagggtcgaagctttgttcgaggcctttta
aatcgcaatccaaatcatcgtttaggagcagttgctgacactactgaattaaaagagcat
cctttttttgcagacataaattgggacctacttagcaagaagaaggttcagccgcctttt
aaaccgaatgttcaaaatgatctggatgtttccaattttgataaagagtttaccaatact
aatgtgaaaaatatcaatatagtttccaatgttgatcccgctaatgcctcgacacctcta
tccaacacgattcaggacagatttcgtggtttcacttttgtcaataagtccattgatgaa
cagtttcagaacctgggactacaagaaaacgaagagacagataatttacatgcgtgtcgc
acaacaacccattcatcggttaattcaataaattcacatgggaatccacgtacggtggat
gctaacgatcccgtcgcagatactgtgttcggcgagacgttcgaagcttga

DBGET integrated database retrieval system