KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1D4.03c
Entry
SPAC1D4.03c       CDS       T00076                                 

Gene name
aut12
Definition
(RefSeq) putative autophagy associated protein Aut12
  KO
K20195  vacuolar fusion protein MON1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    SPAC1D4.03c (aut12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC1D4.03c (aut12)
Membrane trafficking [BR:spo04131]
 Endosome - Lysosome transport
  Others
   Others
    SPAC1D4.03c (aut12)
SSDB
Motif
Pfam: Fuz_longin_1 Fuz_longin_2 Fuz_longin_3
Other DBs
NCBI-GeneID: 2542459
NCBI-ProteinID: NP_593016
PomBase: SPAC1D4.03c
UniProt: Q10150
Position
I:complement(join(641885..642131,642218..643512))
AA seq 513 aa
MEPTSEHSSIKEEVENDNVHRSHESECGSLLLNPGNVLMAAPSVSEDDQEVSRSTPELRS
HVENVEQLLSDILHDNSSPLNVSTSVSSSSNNTAVDEIIKLLSLISFDLAKQKRTYLIFS
SSGKPVFSNIVDDSIEPSTVGALQAIISSFEVSKEELTSFSTFSNVIVVLSKNPLYLVGV
SPSTTLSAAYLLSELNLLYCQILTGVTAKAMQLTLNSRPNFDLRRLIGSNEQFLKELCDQ
LNDYELVPTLNAISPLPLRSSFRDQLSQLLLRETPKSLLFTFIAIRGRLVCMVKAKKLLL
HANDLYLLFLSLFRTQSFNDSMEHWVPVCFPTLNPDAYIYIYSYFLCKDTVLIMGSSESG
VFFEMQSVKCKVAQEIQDHGWLKKLIYCEEMDRTTPRNPGSPCISHYLFYSKKYSQFYTP
GYSFSTPNFNTRTLYAIYASLHDQAFHKKNSFSINMTVHESLLLFTWSTASFDFHCIANA
TTSSQLLIANVNKILRWIRREENRLFIQTNLSF
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggaaccaacatctgagcattcatcaatcaaggaggaagtggaaaatgataacgttcat
agatctcatgagtcggaatgtggatcactgctgttaaaccctggtaatgttctaatggca
gcgccttcggtgtcagaggatgatcaagaagtaagcaggtctacaccagaattgcgaagc
cacgtggaaaacgttgaacaattactttctgatatattgcatgataattcctctccgctt
aatgtaagcacttcagtatcgagcagtagtaacaatacggctgttgatgaaattataaaa
ctactttcgttgatatcttttgatttggcaaaacaaaagcgcacatatttgatattctct
tcatcagggaagcccgtgtttagtaacattgttgatgattcaattgagccatcaaccgtt
ggcgcgttacaagcaattattagctctttcgaagtgtcgaaagaagagctaacaagcttt
tctaccttttccaatgttatcgttgttctctccaaaaatcctctttatcttgttggcgta
tcgccatcgacaactttaagcgcagcatatttactcagtgagttaaacctcttatattgc
caaatacttactggggttactgcgaaagctatgcagctgaccttaaactcccgcccaaat
tttgatttgagaagacttattggaagcaacgagcagttcctaaaagaactatgtgatcaa
cttaatgattatgaattagtccccacattgaatgccatatctcctcttcctttacgttcc
tcttttcgtgatcagctgtcgcaactgctgttgagagaaacacccaaatctctgctgttt
acttttatagctatacgaggtcggcttgtttgtatggttaaggcgaagaagcttttatta
catgctaatgatctctatttacttttcctatcactcttccgcacacagtcttttaatgat
tcaatggagcattgggtgcctgtttgttttcctactctaaatccagatgcttatatttac
atttatagctatttcctatgtaaggacactgtcttgataatggggagcagcgaaagtggt
gtcttttttgaaatgcaatcagtgaaatgcaaagttgctcaggaaattcaggatcatgga
tggttgaaaaagctcatttattgtgaagaaatggatagaactacgccaaggaatcccgga
tctccttgtatttcacattacttgttttattcaaagaaatactcacagttttatactcct
ggctattcattttcaactcccaatttcaatactagaactctttatgctatttatgctagc
ttacacgaccaggcatttcacaaaaaaaattctttctcaattaatatgactgtccatgaa
tctttgcttctattcacgtggtcaactgcatcgttcgactttcattgtattgctaacgct
accactagcagtcaactgcttattgcaaatgttaataagattttgagatggatacgaagg
gaggagaatcgattatttatacaaacaaacctttcgttttga

DBGET integrated database retrieval system