KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1D4.08
Entry
SPAC1D4.08        CDS       T00076                                 

Symbol
pis1
Name
(RefSeq) putative CDP-diacylglycerol--inositol 3-phosphatidyltransferase Pis1
  KO
K00999  CDP-diacylglycerol--inositol 3-phosphatidyltransferase [EC:2.7.8.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00562  Inositol phosphate metabolism
spo00564  Glycerophospholipid metabolism
spo01100  Metabolic pathways
spo04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SPAC1D4.08 (pis1)
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPAC1D4.08 (pis1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    SPAC1D4.08 (pis1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.11  CDP-diacylglycerol---inositol 3-phosphatidyltransferase
     SPAC1D4.08 (pis1)
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-GeneID: 2542487
NCBI-ProteinID: NP_593021
PomBase: SPAC1D4.08
UniProt: Q10153
Position
I:join(650814..650893,651173..651848)
AA seq 251 aa
MRVKFLKLSNDFPFCSGQAMSGVLDTFILTLCLGFTRVFLVLISLYFMSWHPNYCTIVYL
YSSLLDAFDGWAARKLHQATNFGAILDMVTDRCATSCLLCFLCAAYPKYAIIFQLLVSLD
LASHYMHMYSTLHQGASSHKTVTKKHNWMLRLYYGNNKVLFIFCAANEMFFVALYLLSFT
PRTPPKLGYLPVPSFIYSTGELPLSYPTLLAVLCGPICLAKQIINVVQLVNAANALVKMD
VEQRRAAKKLQ
NT seq 756 nt   +upstreamnt  +downstreamnt
atgcgagttaaatttttaaagctgtcaaatgattttcctttttgctctgggcaagctatg
agcggagtattggatacttttattctgactctttgtttaggttttactagggtttttttg
gtacttatttcgttgtactttatgtcatggcacccaaattattgtactattgtgtattta
tactcaagtttacttgacgcttttgatggttgggcggcgcgcaaattgcatcaagccacc
aatttcggtgcaattttggatatggtcacagaccgatgcgccacctcgtgcttgctttgc
tttttatgtgctgcttatccaaaatatgctataatttttcaactgttagttagcttggac
cttgccagccattatatgcatatgtacagcactcttcatcaaggtgcttcctcacacaaa
acggtaacaaagaagcataactggatgctgagactttactatggaaacaataaagtttta
ttcatcttttgcgctgctaatgagatgtttttcgttgctctttatttactatcttttacc
ccacgtactcctcccaaacttggctacttaccagttccttccttcatttattcgactgga
gagctccctctttcctatccgacccttctagccgttttatgtggtcctatttgccttgcc
aaacaaattattaacgttgttcagctggtgaatgctgccaatgccttggttaaaatggat
gttgagcaaagaagggctgcaaagaagcttcaataa

DBGET integrated database retrieval system