KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1D4.12
Entry
SPAC1D4.12        CDS       T00076                                 
Symbol
rad15
Name
(RefSeq) transcription factor TFIIH complex subunit Rad15
  KO
K10844  DNA excision repair protein ERCC-2 [EC:5.6.2.3]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03022  Basal transcription factors
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    SPAC1D4.12 (rad15)
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPAC1D4.12 (rad15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPAC1D4.12 (rad15)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC1D4.12 (rad15)
Enzymes [BR:spo01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     SPAC1D4.12 (rad15)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SPAC1D4.12 (rad15)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SPAC1D4.12 (rad15)
SSDB
Motif
Pfam: DEAD_2 HBB Helicase_C_2 ResIII AAA_11 SNF2-rel_dom YtxC
Other DBs
NCBI-GeneID: 2542203
NCBI-ProteinID: NP_593025
PomBase: SPAC1D4.12
UniProt: P26659
Position
I:664310..667647
AA seq 772 aa
MKFYIDDLPILFPYPRIYPEQYQYMCDLKHSLDAGGIALLEMPSGTGKTISLLSLIVSYQ
QHYPEHRKLIYCSRTMSEIDKALAELKRLMAYRTSQLGYEEPFLGLGLTSRKNLCLHPSV
RREKNGNVVDARCRSLTAGFVREQRLAGMDVPTCEFHDNLEDLEPHSLISNGVWTLDDIT
EYGEKTTRCPYFTVRRMLPFCNVIIYSYHYLLDPKIAERVSRELSKDCIVVFDEAHNIDN
VCIESLSIDLTESSLRKASKSILSLEQKVNEVKQSDSKKLQDEYQKLVRGLQDANAANDE
DQFMANPVLPEDVLKEAVPGNIRRAEHFIAFLKRFVEYLKTRMKVLHVIAETPTSFLQHV
KDITFIDKKPLRFCAERLTSLVRALQISLVEDFHSLQQVVAFATLVATYERGFILILEPF
ETENATVPNPILRFSCLDASIAIKPVFERFRSVIITSGTLSPLDMYPKMLQFNTVMQESY
GMSLARNCFLPMVVTRGSDQVAISSKFEARNDPSVVRNYGNILVEFSKITPDGLVAFFPS
YLYLESIVSSWQSMGILDEVWKYKLILVETPDPHETTLALETYRAACSNGRGAVLLSVAR
GKVSEGVDFDHHYGRAVIMFGIPYQYTESRVLKARLEFLRDTYQIREADFLTFDAMRHAA
QCLGRVLRGKDDHGIMVLADKRYGRSDKRTKLPKWIQQYITEGATNLSTDMSLALAKKFL
RTMAQPFTASDQEGISWWSLDDLLIHQKKALKSAAIEQSKHEDEMDIDVVET
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgaagttctatattgacgatctacctattctgtttccttatccacgcatctatcccgag
cagtatcagtatatgtgtgatttgaaacattctttggatgcgggaggcattgcgctctta
gaaatgccttcgggtactggaaagaccatttctcttttgtcccttattgtttcatatcaa
caacattatcctgagcatcgcaagctcatctattgttcacgtaccatgtcggaaattgat
aaagcattagctgaattgaagcgtttaatggcgtatcggacttcacagttaggatatgaa
gaaccatttttgggtctcggactaaccagtcgcaaaaatttatgtttacacccttctgtt
cgtcgtgaaaaaaatgggaatgtggtagatgcccgttgtcgctcacttacggcgggtttt
gtgcgggagcaaagattggctggtatggatgttcctacttgtgagttccacgacaatttg
gaagatcttgagccacacagccttatatctaacggtgtttggacccttgatgatatcaca
gaatacggcgaaaaaactacacgatgcccctattttactgtacgtcgtatgctaccgttt
tgtaatgttattatttattcgtatcattatttactagaccccaaaattgctgaacgagtt
tctcgagaactcagtaaagattgcattgttgtttttgatgaagcacacaatattgacaat
gtgtgtattgagtctttaagtattgatttgacagaatcttctttgagaaaagcttcgaag
agcattttgtctcttgagcaaaaagtcaacgaagtaaaacagtctgactcaaaaaaactt
caggatgaataccaaaagcttgttcggggccttcaagatgctaatgccgcaaatgacgaa
gaccagtttatggcgaatcccgttttgcctgaggatgttttaaaggaagctgttcctgga
aatattcgacgagccgaacattttattgcatttttgaagcgttttgtagaatatttaaaa
acaaggatgaaagttttgcacgttattgctgaaacaccaacttcttttttgcaacatgtt
aaagacattacatttatagacaaaaagccgcttcggttttgcgctgagcgactcactagt
cttgttcgtgccttacaaatttcactagttgaagattttcattctttgcagcaagtagta
gcttttgcgacccttgttgctacttatgagcgtggatttatcctaattttggaacccttt
gaaacagaaaatgctacagttcccaatccaatattgcggttttcctgtcttgacgcctca
atagctattaaaccagttttcgaaagatttaggtctgtgattatcacgagtggtacttta
tcccccctcgatatgtaccccaagatgttgcagtttaatactgttatgcaggaatcgtat
ggaatgtcacttgcacgaaactgtttccttcctatggtagttactcggggtagcgatcaa
gtagctatttcttcaaaatttgaagcccgtaatgatcctagtgttgttcgcaattacggt
aatatactggttgagttttcgaaaattacacctgatggcttagtcgcattttttccaagt
tatctctaccttgaaagtattgtttctagttggcaaagtatgggtattctagatgaagtc
tggaagtataagttgattttggtggaaacaccagatcctcatgaaacaactctcgcctta
gagacttaccgggctgcttgcagcaatggccgtggagcagtattgctgtcagtcgctaga
ggaaaagtctcagaaggagtggattttgatcatcattatggtagagcagtaatcatgttt
ggtattccgtatcagtatactgagagtcgtgttttaaaagcacggttagaatttctgagg
gatacgtatcaaattcgggaagcagatttcttaacatttgatgccatgcggcatgctgcc
caatgtttaggtcgcgttttgcgtggaaaagatgatcatggaattatggtgttagcagat
aaacgatatggtcggtctgataagcgtacaaaattacctaaatggattcaacagtatata
accgaaggcgctacaaatttaagcactgatatgtccctcgctttggcgaaaaaattttta
cgaactatggcacagcctttcactgcgtctgatcaggaagggatttcttggtggagtctt
gatgatttgttgattcatcagaagaaagcattgaagtctgcggctatagaacaatccaaa
catgaggatgagatggatattgatgtggttgaaacttaa

DBGET integrated database retrieval system