KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1F3.09
Entry
SPAC1F3.09        CDS       T00076                                 

Symbol
mug161
Name
(RefSeq) putative CwfJ family splicing factor mug161
  KO
K24939  CWF19-like protein 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPAC1F3.09 (mug161)
Spliceosome [BR:spo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    SPAC1F3.09 (mug161)
SSDB
Motif
Pfam: CwfJ_C_1 CwfJ_C_2 Nif11
Other DBs
NCBI-GeneID: 2541461
NCBI-ProteinID: NP_593012
PomBase: SPAC1F3.09
UniProt: Q10414
Position
I:join(634937..634971,635069..635235,635349..636176,636234..636314,636385..636959)
AA seq 561 aa
MIFYDKLKPADVLVIGSADGRVIEAIEYIADLHKQHGFKFAICLGNLFSHKRTTSADVVK
LKNEKVKVPIPVYFGVGTAGLPESIISHMAMYGPEVAPNLFCMGICGFMKTFYKFTIAQL
GGSYNEEKYYQPPEKFEQSLNEKCFHRSDVQKLSKRCDILFSSEWPEDVQENSTLPERKL
PKGCMPLAALAANCMPQYFFVPGPVYYEREPYKNSAAINVNTGTVTHFVALAPFKNSKNE
KFSYAFTLYPLTTEYMQPAPPNCTASPFEHRPIPLKRASEDQIIPQQTNKFHKSKSSTAL
FKSKKDSSSSLNKMHKSESHSALNNLHKSESGTSLNNRRSKVGPGSCFFCLSNPNVALHL
IVAIGNEAYMALPKGPLTTTASNTPALASSGHVLIIPIAHASALSTLSDTSYEKTLNEMN
RFRKAVTDMYNACDSDALVYEISRANGVHLHWQMIPIPKISSHRIESVFLEMAKEAGYDF
EERDVEPHELNYFRVFLPSGKILIHRLQLRERFDLQFGRRAAAKILGLEDRVDWRKCVQT
EDEEKAESEAFKMCFKPYDFT
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgattttttatgacaaactgaaaccggctgatgtgctggttattgggtctgctgatggg
cgagttattgaagctatcgagtatattgctgatcttcacaaacagcatggttttaaattt
gctatttgtcttggcaatttgttttcccacaagcgtacaactagtgcggacgttgttaaa
ctaaaaaatgaaaaagtaaaggttcctataccagtctatttcggggttggtactgctggt
ttgccagagtccattatttcgcatatggccatgtatggaccagaggtagcacctaacttg
ttttgtatgggtatttgtgggtttatgaaaactttttacaagtttacaattgctcaactt
ggtggatcttataatgaggagaaatactaccaacctcccgaaaaatttgagcaaagctta
aatgaaaagtgttttcatcgaagtgatgtacaaaagttgtctaaacgttgtgacattttg
ttcagctctgaatggccggaggacgtacaagaaaactctactctccctgagagaaagttg
cctaaaggttgtatgccgttagctgcactagctgctaattgtatgccgcagtactttttt
gttcctgggccagtttactacgaacgtgaaccctacaaaaactctgccgctattaatgtt
aacactggtactgtcactcatttcgtggctttggcccctttcaaaaactccaaaaatgag
aagttttcatacgcttttactctctaccccttgacaactgagtacatgcagccagctcct
cctaactgtactgcttctccatttgagcataggccaattcccttaaagcgtgcttcagaa
gatcaaattattccccagcaaacaaataaattccataaatctaaatcaagcactgctctc
tttaaatctaaaaaagattctagctcgtccctcaacaaaatgcacaagtcagagtcacat
agtgcactcaataatttgcacaagtccgaatcaggcacttcgctcaataatagacggtct
aaagttggacccgggtcatgcttcttttgtttgagtaatccaaatgttgcacttcactta
atagtcgctattggtaacgaagcttacatggcgttgcccaaaggccctcttactaccacg
gcatcgaataccccagctttagcttcctctggtcatgttttgattataccaattgcgcat
gcttctgctttaagtactttgtcggacacctcatatgagaaaactttaaatgaaatgaat
cgatttcgtaaagctgtaactgatatgtacaatgcttgtgattccgatgctttagtatat
gaaattagtagagctaacggagttcatttgcattggcaaatgattcccatccccaagatt
tcctcacatcgtattgaatcagtcttccttgaaatggcaaaggaagctggttacgacttt
gaggaaagggatgtagaacctcatgagctgaactatttccgtgtatttctaccctctgga
aaaatcttaattcatcgattacaactaagagaacgatttgatttacagtttgggcgacgt
gctgctgcaaaaattttgggtcttgaggatagggttgattggagaaaatgcgttcagaca
gaagatgaagaaaaagctgagagtgaagctttcaaaatgtgtttcaaaccttacgacttt
acataa

DBGET integrated database retrieval system