KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1F5.07c
Entry
SPAC1F5.07c       CDS       T00076                                 

Gene name
hem14
Definition
(RefSeq) putative protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00860  Porphyrin and chlorophyll metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01240  Biosynthesis of cofactors
Module
spo_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPAC1F5.07c (hem14)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SPAC1F5.07c (hem14)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SPAC1F5.07c (hem14)
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 TPR_19 Thi4 DUF3458_C
Other DBs
NCBI-GeneID: 2541631
NCBI-ProteinID: NP_592866
PomBase: SPAC1F5.07c
UniProt: Q10062
Position
I:276893..278365
AA seq 490 aa
MSIAICGGGIAGLSTAFYLARLIPKCTIDLYEKGPRLGGWLQSVKIPCADSPTGTVLFEQ
GPRTLRPAGVAGLANLDLISKLGIEDKLLRISSNSPSAKNRYIYYPDRLNEIPSSILGSI
KSIMQPALRPMPLAMMLEPFRKSKRDSTDESVGSFMRRRFGKNVTDRVMSAMINGIYAGD
LNDLSMHSSMFGFLAKIEKKYGNITLGLIRALLAREILSPAEKALKAALLAEPKTAELSN
SMKSTSMFAFKEGIETITLSIADELKKMPNVKIHLNKPAKTLVPHKTQSLVDVNGQAYEY
VVFANSSRNLENLISCPKMETPTSSVYVVNVYYKDPNVLPIRGFGLLIPSCTPNNPNHVL
GIVFDSEQNNPENGSKVTVMMGGSAYTKNTSLIPTNPEEAVNNALKALQHTLKISSKPTL
TNATLQQNCIPQYRVGHQDNLNSLKSWIEKNMGGRILLTGSWYNGVSIGDCIMNGHSTAR
KLASLMNSSS
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtcaattgcaatttgtggaggaggtatagctggtcttagtacagcattttatcttgct
agattgattccaaaatgtactattgatttgtacgaaaaaggtcctcgtttaggtggatgg
cttcagtcggtcaaaatcccgtgtgcagattctccaacaggaacggttttgtttgagcaa
ggtcctagaactcttcgtcctgctggggttgctggcttagcaaacttagatttaattagc
aagttgggcatcgaagacaagttgttaaggatttcgagcaattctcccagcgcaaaaaac
cgatatatttattacccagatcgcttaaatgaaattccttcaagcattttagggagtata
aagtcgattatgcagcctgctttgcgtccgatgcctttggctatgatgcttgagcccttt
cgtaaaagtaagcgagattcgacagatgaaagcgtgggttcatttatgagaagaagattt
ggtaaaaacgttacggatagagttatgagtgcaatgataaatggtatttatgctggtgat
ttgaatgatttgtctatgcattctagcatgtttggatttttagcgaagattgaaaaaaag
tatggaaacattactttgggattaattagagctcttcttgcacgtgaaatattatctcct
gctgagaaagctttgaaagcagcactactcgcagagccaaaaacagcagagctgtcaaac
agtatgaaatcgacaagtatgtttgctttcaaggaagggattgagactattacattgtca
atagcagatgaattaaaaaaaatgccgaatgtcaagatacatctaaacaaaccggccaaa
actttggttccacataaaactcagtctcttgtagacgtcaatggtcaagcttacgagtat
gttgtgtttgcaaactcttctcgcaatttagagaatctaatatcttgtcctaaaatggaa
actccgacgtcgagtgtttatgtcgtcaacgtttattataaggaccctaatgttcttcca
atccgtggttttgggcttttgattccatcatgcactccaaataatccgaatcatgttctt
ggtatcgtttttgatagtgagcaaaacaaccctgaaaatggaagcaaggtcactgtcatg
atgggagggtctgcttatacaaaaaatacttctttgattccaaccaaccccgaagaagcc
gttaacaatgctctcaaagctttgcagcatactttaaaaatatccagtaagccaacactc
acgaatgcaacattacaacaaaattgcatccctcaatatcgtgttgggcatcaagataat
cttaattctttgaaatcttggattgagaaaaatatgggagggcgaattcttctaactgga
agttggtataatggtgttagtattggggattgtattatgaatggacattcaacagctcga
aaactagcatcattgatgaattcttcttcttga

DBGET integrated database retrieval system