KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1F5.08c
Entry
SPAC1F5.08c       CDS       T00076                                 

Symbol
yam8
Name
(RefSeq) calcium channel regulatory subunit Yam8
  KO
K08284  calcium channel MID1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC1F5.08c (yam8)
Transporters [BR:spo02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   SPAC1F5.08c (yam8)
SSDB
Motif
Pfam: Mid1
Other DBs
NCBI-GeneID: 2541627
NCBI-ProteinID: NP_592865
PomBase: SPAC1F5.08c
UniProt: Q10063
Position
I:275089..276549
AA seq 486 aa
MFFFSTHLILKILFFWSITRNIFGATYTSLLLNNTINGNINDQSTAYYNLTWEGNTAYNV
SLTLSTCTAFDGANDLMLYISNNTFDEALPLDNFTITASENGLATIFVTGYSPLYIAVSS
AFSQFAPNFFVESGESTLEGNNVINYELAAGIDTPFSQYNATKFLFAQDTDFQAALLITG
NLTTNETSIIPSYEIYVNPSNSTYDNTFNKFSSSFCAFQNNPSTVNTNNADRSMTLRGLG
PFAKEQFYLKGLDPNVTYTAYLVEPNIGQPGGTVYPGVTFTTKTSPACQLIYDLQFCSEV
AYAVPGNSSLFSASALAEWYDQQAYGYYQNFTYTLDLIPCNATSWSAYSLLKNCSDCANS
YKNWLCASVIPRCADINDNSSYLIYKNYDSRYPLIDEVIQPGPYKEVLPCSYLCYSLASS
CPLDLGFACPKAGYGLEFSYGEVSNVTGLITCNAPGVEFYESGSALLNISWRTFFISLIF
WILFVE
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtttttttttagcacccatttaattttgaagatactctttttctggtcgataactaga
aacatatttggcgctacttatactagcttgctgctgaacaataccataaatggtaatata
aatgatcaaagcactgcttactataacttaacatgggaaggaaacacagcttacaacgtt
agtctaactttatcaacctgcactgcttttgatggcgcgaacgatttgatgttatatata
tcgaacaatacgtttgacgaagctcttcctttagataattttacgattactgcttctgaa
aatggtctagcaacgatatttgtaaccggctactcacctttatatattgctgtgtccagt
gctttttctcaatttgctcccaatttttttgtcgagtcaggtgaatctactttagaaggt
aataatgtgattaattatgaattagctgctggaattgacactccctttagtcaatacaat
gcaactaaatttctgtttgcccaggacaccgactttcaagcagcactactcattacggga
aatctcactacaaatgagacctccatcatcccttcttatgagatatatgtcaacccttct
aactccacttatgataacacatttaacaaattttcaagttctttctgtgcttttcaaaac
aacccctcaactgttaacactaacaatgctgatcgctcaatgacccttcgtggtctcggt
ccttttgctaaagaacaattttatttgaaaggtttggatcccaacgtcacttacacagcg
tatctagtcgagcccaatatagggcaaccgggtggtactgtttacccaggagtcactttt
accacaaagactagtccagcttgtcaattgatctacgatctgcagttttgctcagaagtt
gcttatgctgtgcctggaaattctagtttattttctgcatcggcattggcagaatggtat
gatcagcaagcttacggatattatcaaaactttacttatactctcgatttgataccttgt
aatgctacatcttggtctgcgtattcattattaaaaaattgtagtgattgtgccaacagc
tacaaaaattggctttgcgccagtgtcattccgcgatgtgccgacattaatgataattct
tcctacttaatttacaaaaactacgattcccgttatccacttattgacgaagtaatacaa
ccaggcccctataaagaggtccttccttgctcttatttatgctattcattagcttcaagt
tgtcctttagatttaggctttgcatgcccgaaggctggttatggccttgagttttcttat
ggagaagtgagcaatgtaacaggattaatcacatgtaatgcacccggagtggaattttat
gaaagtggttctgctcttcttaacatttcatggcggactttttttatttccttgattttc
tggattttgtttgtcgagtaa

DBGET integrated database retrieval system