KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1F7.07c
Entry
SPAC1F7.07c       CDS       T00076                                 

Gene name
fip1
Definition
(RefSeq) Fe permease Fip1
  KO
K07243  high-affinity iron transporter
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC1F7.07c (fip1)
Transporters [BR:spo02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SPAC1F7.07c (fip1)
SSDB
Motif
Pfam: FTR1 Cation_efflux Ctr
Other DBs
NCBI-GeneID: 2541557
NCBI-ProteinID: NP_594493
PomBase: SPAC1F7.07c
UniProt: Q09919
Position
I:complement(4233303..4234496)
AA seq 397 aa
MAKDVFSVAIFFIVLRETLEASIIVSVLMSFISQTLMDKDGNVTDPKLKRKFMLQVWIGS
FTALFICLAIGGGFIGAFYALDKDIWSGSEEIWEGVFSLIAVVLITVMGFAMLRVSHLQE
KWRKKLMKSIANRKAKGISNWGKKYSMFLLPFFTVLREGLEVVVFVGGVGLETPATAFPL
PVICGLIVGCLIGYFIYRGGNVMNLQWFLIASTCILYLISAGLMSKATFYFEMNKWNHQT
GGDAGELGDGPGSYPFKSAVWHVNYGNPEMNSNGGYMIFNAILGWNNTGTYGSILSYIIY
WLFVAFIMFLMWYKERRAARLLIAKLGDKVVDLEAASSHTPVQSSSSEDEFKINSPTDDK
GDKAIDIVTEVRESSSPVEEHKDDKTVDVINEIRESH
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcaaaagacgtcttttccgtcgctatcttcttcatcgtccttcgtgagacccttgag
gcttccatcatcgtctcagtcttgatgtccttcatctcccaaacactcatggataaagat
ggaaacgtgacggatccaaaactaaagcgaaaatttatgctgcaggtttggatcggttcg
tttactgctttgttcatttgtttagccattggcggtggctttatcggtgctttttatgcc
ctcgacaaagatatttggagtggttccgaagaaatttgggaaggtgtcttctctctcatc
gctgtcgtcttgatcaccgtaatggggttcgctatgcttcgtgtctcgcatttacaggag
aaatggcgcaagaaacttatgaaaagtatcgccaatcgcaaggccaaaggtatctccaat
tggggtaaaaagtattccatgtttctccttccctttttcaccgttctgcgtgagggtttg
gaagtcgtcgtctttgtcggtggtgtcggtttggaaacacctgccaccgctttccctctt
ccagtcatttgcggtctcatcgttggttgtcttatcggttactttatctatcgtggtggt
aatgtgatgaacttgcaatggttcttgattgcctcaacatgtatcctctaccttatctcc
gccggtcttatgtccaaggccaccttttactttgaaatgaataagtggaatcatcaaact
ggtggtgatgctggtgagctcggtgatggtcccggttcctatcccttcaaatccgccgtt
tggcacgtcaactatggtaatccagagatgaattccaatggtggttacatgatcttcaat
gccattctaggttggaacaacactggtacctatggttccatccttagctacatcatctat
tggcttttcgtagccttcatcatgttcctcatgtggtacaaggaacgtcgtgctgcaaga
ctccttattgccaagctcggcgacaaagttgtcgacttggaggctgcctcttcacacact
cccgtgcaatcctcctcctctgaagatgaattcaaaatcaattctcctaccgatgataaa
ggcgacaaagccatcgatatcgttaccgaagttcgcgagtcttcttctcccgtcgaagaa
cataaagacgacaaaactgtcgatgtcatcaatgaaattcgtgagtctcattaa

DBGET integrated database retrieval system