KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1F7.08
Entry
SPAC1F7.08        CDS       T00076                                 

Gene name
fio1
Definition
(RefSeq) Fe transporter/Cu oxidase Fio1
  KO
K19791  iron transport multicopper oxidase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC1F7.08 (fio1)
Transporters [BR:spo02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SPAC1F7.08 (fio1)
SSDB
Motif
Pfam: Cu-oxidase Cu-oxidase_2 Cu-oxidase_3
Other DBs
NCBI-GeneID: 2541558
NCBI-ProteinID: NP_594494
PomBase: SPAC1F7.08
UniProt: Q09920
Position
I:4235639..4237507
AA seq 622 aa
MNKFFSFPILGLLLTCVRFVVAKERLFEWNVTDVYDVDPDGSGNSRWVIGVNNKWPIDPL
VVDYGDQVIIKMTNSLANNRTTSLHSHGLFQKFTPYMDGVPQSTQCEIPPGATFYYNYTA
LQNGTYWVHSHDMSQYPDGLRTPFIINALEEPYDYDEEYIISMTDWYYTPFNILVPDEFK
TWKNPTGAEPVPDTGLFNDTANATFAMEPGKTYRLRFINIGAFNNYDVMIEDHNMTIIEV
DGEYTEPQEVSSIHLTVAQRYSVLVTAKNSTDRNYAITAYMDESLFDTIPDNYNPNVTAW
LSYNSDASYDLGPDIDEIDSYDDAELNPLYSWDVTESNHSINIWFDFFTLGDGANYAEIN
DSSYVFPKVPSIMIANSTNVDGYNLEPVTYGPYTNAYIFEYGDVVDVIIDNHDTGKHPFH
LHGHTFQVLERGEENAGLYSDQESHTYYDNPMRRDTVEIEPGSFIVIRFIADNPGAWVIH
CHIEWHMESGLLATFIEAPEMIPSISSPDFVKEQCMLDGVPTIGNGAGNYKNISDLSGAP
SPPGEMPAGWTSKAIGTMAACVISACIGMGSIIFYGASIHPVPTEELDENDDLQEAALEN
AAMFLDTDKAVEKVVEGKDEIK
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgaataaatttttctccttccccattctcggccttcttcttacatgcgttcgcttcgtc
gtcgccaaggaacgcttgtttgaatggaatgtcacagacgtttacgacgtcgaccctgat
ggatcgggaaattcccgctgggtcattggtgttaataacaaatggcccatcgatcccctt
gtcgtcgactatggtgaccaagtcatcatcaagatgaccaattccctcgccaataatcga
actacttctttgcattctcatggcttgtttcaaaagttcactccttacatggatggagtg
ccacaaagcactcaatgcgaaattcctcctggtgccactttttactacaactataccgct
ttgcagaatggcacctactgggttcattctcacgacatgtcccaataccccgatggcctt
cgtaccccttttatcatcaacgcgttggaggagccatacgattacgatgaggagtatatc
atttccatgacggattggtactatactcctttcaacattctcgtgcccgatgaatttaaa
acttggaaaaatcccaccggtgccgagccagtccccgataccggtcttttcaacgatact
gccaacgctacttttgccatggagcctggtaagacatatcgtttgcgcttcatcaacatt
ggcgctttcaacaactacgatgtcatgatcgaggatcacaacatgaccatcatcgaagtg
gacggcgagtacacagagcctcaagaggttagctccatccaccttacagtcgctcaacgt
tacagtgtgcttgtgacagcgaagaattccaccgatcgcaactatgccatcaccgcttac
atggacgagtcgctattcgatacgattcccgacaattacaaccccaatgtaacggcctgg
ctttcttacaattcagatgcttcatacgatctagggcctgacattgacgaaatcgattcc
tacgacgacgcagagttgaatcctctctatagctgggatgtcacggaatccaatcattcc
atcaacatatggtttgactttttcacccttggtgacggtgccaactatgcagaaatcaac
gattcatcctatgtgttccccaaggtcccatccatcatgattgccaacagcaccaatgta
gatggctacaatttggagcccgtcacgtatggaccctataccaatgcatatattttcgag
tatggtgatgtggtggacgttatcattgacaaccacgatacaggaaagcaccccttccat
cttcacggacacacctttcaagtgttggagcgtggagaagaaaatgccggactgtactcg
gatcaagagtcgcacacatactatgacaatccaatgcgtcgtgacaccgtcgaaatcgaa
ccgggaagtttcattgtcattcgtttcattgccgataacccaggtgcctgggttattcat
tgccatattgaatggcatatggagagtggtttattagctacgtttattgaagcaccggag
atgatacccagtatctccagtcctgattttgtgaaggagcagtgcatgttggatggtgtt
ccaacgatcggaaatggtgctggtaactacaagaatatttccgatttgtctggtgcaccg
tctcctcccggtgaaatgccagctggctggactagcaaggcaattggtacaatggcagca
tgtgtgatttcagcctgtattggcatgggatcgattatattttacggcgcctctattcat
ccagtgccgacggaggagttagacgagaatgacgatctgcaagaggcagcattggaaaat
gcagctatgtttttggacactgacaaagctgttgagaaagtggtggaaggaaaagatgaa
ataaaataa

DBGET integrated database retrieval system