KEGG   Schizosaccharomyces pombe (fission yeast): SPAC1F8.06
Entry
SPAC1F8.06        CDS       T00076                                 

Gene name
fta5
Definition
(RefSeq) glycoprotein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: GLEYA
Other DBs
NCBI-GeneID: 2541854
NCBI-ProteinID: NP_592795
PomBase: SPAC1F8.06
UniProt: Q92344
Position
I:100011..101168
AA seq 385 aa
MNSYISLIFTLLFFTSAARSSSVSVETGSCVRYTTIYSSGSSEFTSTITPETPSSSSSTF
VPISTHTSSATNTTSGQLSISSSSSTSSEYSSSSIPITTVSSSDSFIPSSSQTISASSST
TDNVIVSSSISSTVSSTPVSTIYSGTSGTTFVSSSTTYQVIPTQICDGVRGLEYAVYNYD
LPSESTFCHPSNGYTEVSTFNKPAYFGSKDLKQSAPLFTGIFSSLDDIPTYSASDYLPAY
PPNPEGMSSTSSSCKTIVYQFFFRVPATDNWSLFVKNVDDAFFGWFGDKAISGWSNVNYD
AYAHWRIGAYGMGTFDLGYLEQDSFVPVRFVLANGAYIGGFDFAFNSSSTGPVRTTSYSY
TSTCDKSFLPFGKGNGGLDEGTANV
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaattcgtacatttccttaatatttacactgcttttttttacgagcgctgctcgttca
agcagcgtctcggtggaaactggcagttgcgttcgttacacaaccatctatagctctgga
tcatccgagtttacttctactatcacccccgaaactccatccagttcctctagcacattt
gtcccgatttcaacccatacttcaagtgctacgaacaccacctctggccaactttctata
agcagctcaagttcgacttcgtctgagtattcatcttccagtatccctatcacaactgtt
agttcttctgactcattcattccttcatcatctcaaactataagtgcttcaagctcaaca
actgacaatgtcattgtaagcagttcaataagctctactgtttcaagtacaccagtttct
acaatttatagtggaacatcaggtacaacattcgtttcttcatccacaacttatcaagtt
attccaactcaaatatgtgatggagttcgtggattagaatacgcggtatacaattatgac
ttgccttctgagtctacattctgtcacccttcgaatggttataccgaggtgagcactttt
aataagccagcctattttggatctaaagacttaaagcagagtgcgcctctttttactggt
atattttcatctcttgatgacattcccacctattctgcttccgattatcttcctgcttat
cctcctaatcctgaagggatgtcttccacttcatcttcatgcaaaacaattgtttatcaa
tttttcttcagggttcctgctactgataactggagtttattcgttaagaacgtcgatgat
gctttcttcggttggttcggagacaaggcaatttctggatggtcaaatgttaactatgat
gcatacgctcactggagaataggtgcctatggtatgggaacctttgatttaggttatctt
gaacaggatagctttgttccagttagatttgttttggctaatggagcttacattggtgga
tttgactttgccttcaattcttcttcgactggtcccgttcgtaccacgtcatactcctac
acttccacttgcgataaatctttcttacctttcggaaaaggcaacggtggattggatgaa
ggtactgcaaatgtttaa

DBGET integrated database retrieval system