KEGG   Schizosaccharomyces pombe (fission yeast): SPAC20G4.03c
Entry
SPAC20G4.03c      CDS       T00076                                 

Gene name
hri1
Definition
(RefSeq) eIF2 alpha kinase Hri1
  KO
K16194  eukaryotic translation initiation factor 2-alpha kinase 1 [EC:2.7.11.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPAC20G4.03c (hri1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPAC20G4.03c (hri1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPAC20G4.03c (hri1)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   SPAC20G4.03c (hri1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 2541728
NCBI-ProteinID: NP_594738
PomBase: SPAC20G4.03c
UniProt: O13889
Position
I:complement(4818259..4820373)
AA seq 704 aa
MLGTSTKCSKRDCNYAKENISRIMPTIGLGYKQNFEKKTADTQSSCKLLLVALLESFCKH
SDQTPEQSKQMFLYVAHSLQNSGIIDFEFSEELEPIRNAYADSLHNLLSKAFRSTLPMSS
TKDSKKSRYSSPDGVLAKTASFLSVLSDGGYEDDVMNVKPSVNVLSNRLNHLPVEALESC
FPQTTLESSTFADFCEHKDGTGNLSFSNFDSFPTVQRSRYASDFEELELLGKGGYGSVYK
ARNKFDGVEYALKKIPLRLRSFSTSSNIFRESRTLARLNHPNVIRFFSSWVELLPSSEKQ
IEEEPLASADETLSQSADIDNFMFDMDTGLLQHTYPSSVQILFQEDSVADDLTPCYSTKN
STCNLTDLFKKEADQDYAESHDCSSTTSQVDTLGKLAPTKSASEMLLMDSFLSEREEDEC
SNIPSFDQQPLCLYIQMALCEETLEKHINRRNKHIHGVMSKGLRNCYILLFARILEGVLY
LHDAMHLVHRDLKPRNIFLSSGVHSEPCSVCLPNFSDEDNVEVSNAYEPVNQRTLCVVPK
IGDFGLVLSQSDNLEEGTNSSAESSFVGTSTYAAPELFSKHMRSVMNNNSSTDIYALGIL
FFELLYPFNTRMERASAIANLKKGIFPHDFLDSMPEEASLIRSMLSSSNKRPTAAQLLTS
NLFHDLVVNELHVYQALLEDAEKRNNNLKAELNILRVLNPNYDC
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgctcggcacttctactaaatgttcgaaaagggattgcaactatgccaaggaaaatatc
agtcggattatgccgacaattggtctcggttacaaacagaatttcgaaaaaaaaaccgcg
gatactcaaagttcctgcaagttgcttctcgttgcgttgttagaaagcttttgtaagcat
tctgatcaaactccagagcaatcgaagcaaatgtttttatatgttgctcattcgcttcaa
aattcaggtatcatagattttgagttctccgaggagcttgaaccaattcgtaatgcttat
gccgattctcttcataacctcttatctaaagcttttcggagtaccttacccatgagctct
actaaggattctaagaaatcgaggtattccagccctgatggcgttttggcgaaaactgct
tccttcttgagcgtattgagtgatggtggatacgaagacgatgtgatgaatgtcaagcct
tcagtaaacgtattgtctaataggttaaatcatttaccagttgaagcattggaatcttgc
tttccacaaaccactttggagtcctccacgtttgctgatttttgtgagcacaaagatgga
accggtaacttgtcttttagcaactttgatagctttcccacagtccaaaggtcaagatat
gcaagtgattttgaagaacttgagttacttggtaaaggcggttatggttcagtgtataaa
gctcgaaataaattcgatggagttgaatatgctttaaaaaaaattccacttcggttacgt
tctttctccacttcttctaacatattccgtgaatctaggaccttggcaagattaaaccat
cccaatgtgataagattcttttctagttgggtcgagctcttaccgtcatctgaaaagcaa
atcgaagaagaacctttagcttcggcagatgagacattatctcaatcagcagatatagat
aattttatgtttgatatggatactgggttacttcagcatacttatccttcatcagttcag
atactattccaagaggactcggttgcagatgatttaactccttgttactctaccaaaaat
tcgacttgcaacttgactgatcttttcaagaaagaggccgatcaggattatgccgagtca
catgattgttcttcaacaacatcacaagtcgacacattaggaaagttggcgccaacgaag
tcagcttctgaaatgttacttatggattcatttctatccgaaagagaggaagatgaatgt
tccaatattcccagctttgatcaacagcccttatgtttgtacatacaaatggctctttgc
gaagaaacactcgagaaacacataaacagacgaaataagcatattcacggtgtaatgtct
aaaggcctacgtaactgttatattttactgtttgcaaggattttagagggcgttttgtat
cttcacgatgctatgcatttagtccatcgtgatttgaaacctcgaaatatttttctatct
agtggtgtacattctgagccttgctctgtgtgtctacctaatttttctgatgaagataat
gttgaggttagcaatgcgtacgaaccagtgaaccaaagaactttatgtgttgtgcccaag
ataggcgatttcggtcttgttctttctcagtcagataatttggaagaggggaccaactcc
tcagctgaatcttcttttgtcggtacaagtacgtatgcagctcctgaacttttctcaaaa
cacatgcgatcggtaatgaataacaactcgtctactgacatatatgcattgggcatactc
ttttttgaattactgtatccttttaacacgcgcatggaaagggcatcagctatcgccaat
ttaaaaaagggcattttcccccatgatttcttggattccatgccagaggaagctagctta
atccggtcaatgctcagctcttcgaataagcgcccaactgctgctcaacttttgactagc
aatctatttcatgatttggtagtcaatgagcttcatgtatatcaagctttattggaagat
gctgagaaacgaaataacaatttgaaagcagaactaaacatacttcgagttttaaacccc
aattacgactgttag

DBGET integrated database retrieval system