KEGG   Schizosaccharomyces pombe (fission yeast): SPAC20G8.02
Entry
SPAC20G8.02       CDS       T00076                                 

Definition
(RefSeq) putative DDHD family phospholipase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DDHD DUF676
Other DBs
NCBI-GeneID: 2541976
NCBI-ProteinID: NP_593319
PomBase: SPAC20G8.02
UniProt: P87109
Position
I:1390637..1392910
AA seq 757 aa
MILYIVLPFYVRTKPYSILPSYSSLQWITNAWCSLPSIYILCHCSKHQEEITILALKPLI
AMNNSEEWPLKHVQPPKLSFRHLLSRSVTDAPSLRVRWFYAVDRPLRKSRTGPTEIKKAK
NFLPFSAEDSEHIEKSYLKAVENDGQSEPVNVNEDYLYSVNVVSRELSPIYWDGPVYRIL
RGTWFFSRGDKLYPCEENLATQVEEGYLNSCPYREFSNEKDSAAAQSKTWALLGRYTGGF
VQYTGSRNARLVYDDFYRNVSVKIMNRFSPASFHRSDKLVRGYELDMLESNSKPSTPVPT
EELTSTTLLNDSSDPSDNFTPSNTESTIDLPSATDASHLMSRPDREVNHLILCCHGIGQK
MGERVETVSFVKDISNFRKTLKKTFNSSPDLQAVYPKLKGGGNGVQCLPLLWRQDIRFGM
ARDLDSSFADDDDDDDESLNMSRDLALDDLEDDSIPTLDNINIPTVTGLRNIISDVLLDV
LLYCQPNYRDKILAAVVKRLNRLYNLYKKNVPSFNGHVSLLGHSLGALILFDIIRYQGNI
KYSKLQLDFPVANFFALGSPLGLFQMLNGKKIAGPIPKTNLTRSLSYSEQSFDSGVSILS
CQNFYNIFHPTDPISYRVEPLVVKQMARLKPQKISHFRPHQDLSSSGVGHKIAGGALNVL
SGLRSGIANTLILKSLSYASVFNEATADSHDESQGAENIRDWHIDERMYRLNKTGRIDFM
LQEGALDTSYSYVSAMNAHSEYWKNVDLAHFILTQLL
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgattttatacattgtattaccattttacgttcgtaccaagccttactctattttgccg
tcatattcctccttacagtggattacgaatgcttggtgttcattaccgtccatatacatt
ttatgtcactgtagcaaacaccaagaagaaattacaatattggctttaaagccattaatt
gctatgaataattcagaagaatggccattgaaacatgtgcaaccgcccaaattgtcattt
cgtcatttgctatcgagatctgtgacagatgctccttcattgcgggtacgttggttctat
gcggtagatagaccgcttaggaaatcaagaacgggaccgacggaaattaaaaaagcaaaa
aattttttacctttttcagctgaagactcggagcacatcgaaaaaagttatttaaaggct
gtagaaaatgacggtcaatctgaaccggtcaatgtgaatgaggattatttgtattcggtg
aacgttgtttcaagagaactctcaccaatatactgggatggtcccgtttaccggatactc
aggggaacgtggttttttagtcgtggggataaactgtacccttgtgaggaaaatctagcg
acacaagtggaagaaggttatttaaacagttgtccctatcgagaattttcgaatgaaaaa
gactctgctgctgcacaatcaaaaacatgggccctccttggaaggtatacaggtggattc
gtacaatacactggcagcaggaatgcccgactggtgtatgatgacttttatcgtaacgtt
tctgtgaaaattatgaatcggttttctcctgctagctttcacagaagtgataaattggtg
cgaggctatgaactggatatgttggagtcgaattcgaagccgagtacacctgtccctact
gaggaattgacttctaccactcttttaaacgattcttcagatccaagtgacaactttaca
cctagtaataccgaaagtacgatagaccttccatccgcgactgatgcctctcatttaatg
tcaagacccgaccgggaagttaatcatctaatattgtgctgtcatggcatcggtcaaaaa
atgggtgaacgtgtggaaactgtcagttttgtaaaggatattagtaactttcgtaaaact
ttaaaaaaaacctttaattcttctccagacctgcaagctgtgtatcccaaactgaaggga
ggtggaaacggtgttcaatgtctgcctctgttatggcgtcaagacataagatttggcatg
gcaagggaccttgattcgtcttttgcggacgatgatgacgatgatgatgaatcattgaac
atgtctagagatcttgcattagacgatttggaagacgattccattccaactttggataat
ataaatatccctacggttactggattgcgaaacattatttcggatgttttgctagacgtc
ctcttgtattgtcagccaaattatcgagataaaattttggcagcagtggtgaagcgactg
aatcgtctgtacaatctgtacaaaaaaaatgtcccctcatttaatggccatgtttcactt
cttggacattccttgggggctctaattttatttgatattatacgttaccaaggaaatatc
aaatactcaaaactgcaacttgactttcctgttgcaaactttttcgccttaggtagccca
ttgggattatttcaaatgctgaatggtaaaaaaattgcaggtcctattcctaaaacgaat
ttgactcgcagtctaagttattctgagcaaagtttcgattcgggtgtctcgatccttagc
tgtcaaaacttctataatatatttcatcccactgaccccatcagttatcgtgtagagcca
ttggtggttaagcaaatggcccgcttaaaacctcagaaaatttctcactttcgccctcat
caagacctttcaagttctggtgtagggcataaaattgccggtggtgctctgaatgttctt
tctggccttcgatctggtattgctaataccctaatcttaaaatcattgagttatgcttct
gtgtttaacgaggccaccgctgattctcacgatgaatcacagggagctgaaaacattcgg
gattggcatattgatgagcgaatgtatcgattgaacaaaacgggacgtatagacttcatg
ctacaagaaggtgcactagatacttcttatagctatgtctcagcaatgaatgctcactct
gaatattggaaaaatgttgatcttgctcattttattctaacccaattactttaa

DBGET integrated database retrieval system