KEGG   Schizosaccharomyces pombe (fission yeast): SPAC20G8.06
Entry
SPAC20G8.06       CDS       T00076                                 

Gene name
not1
Definition
(RefSeq) putative CCR4-Not complex subunit Not1
  KO
K12604  CCR4-NOT transcription complex subunit 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SPAC20G8.06 (not1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPAC20G8.06 (not1)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     SPAC20G8.06 (not1)
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     SPAC20G8.06 (not1)
SSDB
Motif
Pfam: Not1 CNOT1_CAF1_bind CNOT1_TTP_bind DUF3819 CNOT1_HEAT
Other DBs
NCBI-GeneID: 2542001
NCBI-ProteinID: NP_593323
PomBase: SPAC20G8.06
UniProt: P87112
Position
I:1403322..1409624
AA seq 2100 aa
MKSQEQQTPETREKSSSTSESGHPISLDSKTPPPNDSKIESIVKAQILFLLSTLREDQYD
TKLEQIRQLINKNAPRVYHHFLRRLIQGNSYRIFGTGKSSDGLATYKLLLDELKSLTKSW
VMAKRFSDAISGSDSEVFEDFDIEAFLDHFQFSPLERTNLLIGLTTSVKPTLAKKASALL
KNTFQSLLNQLSDPTQQQSIDKNDLDLLREGLFTTDYDRIPLIKVPKFDAIIEKKLANSR
PLTALFGPMKASKATLKSMKEAILKKYPPGTATETDVAYLINSLVAIHDYGAWDTVLMGK
AIVSSFENLNWEAMLSMFDNPKFMITGTPSLVLFFTIFTNAYKLRQTNFTLDFLWVLWRN
PLPQLSIISHIILSPTSMFDIREFNVNPVVSVDSLKDYSEELVNYAKIYEKSNLNCIELV
QILLRLLSEVVTYETSLFLNFLDEKVSAELLLLGTLQLPLAWNPVQESLAFQWCSDFFSN
FKEHKFVFVRIERTNPQFLFAFLRSLWLKDSSSVNQVVEFIIENDFTSHIGNIQPNRFAL
EIAALAAARKALSFQDWLDKKMLEFEDADGLNVFLVEVLDFLMSRAALQKNESEQKEESV
VLSIDTVNVLLTTLMDNVSISEEVSEHIKDVQILCLQVYPRLFSLGHDRDSIVIATNTTN
SFSPDVESEVESYFQALYERRISIGKIVLTLQNFKKSENPRDLDLFACLQHSLFDEYRFF
PDYPLEALALTAVLFGSLIQFELLSFVPLGVALRYVYQALLMPTDSKMFRFGMQALVQFQ
EKLPKYINYCNLILGIPSLQLVRPDIYDSIREMIASNENTEVEKDKLDSFSALANPASPK
APEYTFVSIHVPPLNVPNAEGEIEESVCDNILFAINNLSQLNFNEKLKDVKDNLTPAYLP
WFSHYIVTQRVSREANFLSLYGKFLEELKSSDLYKIVFRDTLQAILDIMNNNAETLSPSE
KTNLKNLGSWLGSITLLRNKPITTLQVSFKDLLLEGIDSGRIDRVLPFVCKVLEKASSSV
IFKPPNPWLMGILKLLVELYQFADFRLNLKFEIELLLNNLNVKMDNIEPSEMYRNHLVQK
ADLEKELPEDVLNAEFPDGTDVITQYIVAASSQITVTDAVAQVFGKPKPAIKNITQLIIQ
QSVLEIISAVVRRSVGIAAITTKSLLQKDFAAESNPSRLLLAARQMAKTLAGNLAMVTCR
EPLQMLMINNFRTIALQDVENVHAAVAQAIDELVSQNLFVASSVIESVASETAIAEIDAE
IEHMIVERVRHRKTTPNLPFVDPAGAANLHLNLPSVLKLSSELTPQQFQLYENFDRLSLS
TIMSNNSFTSLNGLRTDSADSTDALNSNLNNTVENEANQTALNYARNLLIIIGQLFQLAA
QMPYTSMQEVPADHELHELVNQFLTGVASINHPIADHVFLLCAQECCRILLTDSKSPFIL
EVFSAILEYICQASTKTAINVSLYWNFSNDLEKLNLPIILSLIRFGILTSGEVDYHVARG
VRSEQGSGPVTDFAIELLRTAVGGENPMALPGNFVNSITSLYEISESFSGETKQAYEQLV
ETMNKSVSPASEILSDLDNKQQLNDQIIIVFVSWVHLLRNSATNDETKAAFVYQLHKQGI
LSEPELCIQFFRCNLEAVLVAFLEAASVNAPDYFNVDAYASLLVNVVKYTEGSTEGTVSS
KSVLFRKIIALIIGVFAELHNSMAEFVHQKTFFRLFSSILSELDDAKDVLESCFVDIYSV
ILECFLAIQPRSFPAFTFAWLSLISHSYLLPKVLLVNNDKINDLFSEILMSFLKFLDLKD
DIDKAQFKLLYNGFLRIILVLLHDFPGFLATHCYQLIPYIPLECVQLRNMVLSAFPSDLH
LPDPFAQGLKVGRLPEVTRAPLISNSVSASLEKFASALDLEACFSSSKPAEVAKLLLEVY
SSQDTPTKLNEWANYFMLCLIRHATRDSPAKQAPQFQSKSPECVIISTMNRSCDSKCRYF
LLTAIANQLRYPSSHTYYASCCFLYLFKSSSNNPQELLIKEQMTTVLLERIICNRPHPWG
LLITFTELLKNEDYNFWKHPYIKRNDEICRLFDSLHEHVMAPSSANNVSTEEATELMGQV
NT seq 6303 nt   +upstreamnt  +downstreamnt
atgaagagccaagaacaacaaacgccggagacacgagagaaatctagttcaacttctgaa
tctgggcatcctatatcactagattctaagacccctccaccaaacgattcaaaaattgaa
agtattgttaaagcacaaatccttttcttattgtcgaccttacgggaagaccaatatgat
acgaaacttgaacagattcgtcaacttatcaacaaaaatgcacccagagtataccaccat
tttcttcgccgtctaattcaaggaaattcataccgtatttttggtaccggtaaatcttct
gatggactagctacttataaattactactagatgaattaaaatctctcacgaagtcttgg
gtcatggcgaaacgttttagtgatgctatttcaggttctgattctgaagtatttgaagat
ttcgatatagaggcatttttagaccatttccaattctccccgttagaaaggactaacctt
ttaattggacttaccacttctgttaaacctactttagcaaagaaagcttctgctttgctt
aaaaacacattccaatctcttttaaaccaactatccgatcctactcagcaacaaagtatt
gataaaaacgatttggatttgctcagggaaggtttgtttaccaccgactatgacagaata
cccttgattaaagttccaaagtttgatgctataattgagaaaaagttggcgaattcacgc
cctcttacagctttgtttggtccgatgaaagcttccaaagctacacttaagtctatgaaa
gaagcaattcttaaaaaatatcccccgggaacggctactgagactgatgttgcttatctt
ataaattcacttgtagctatacatgattatggtgcttgggacactgttttgatgggtaaa
gctatcgtttcctcttttgaaaacctaaattgggaagctatgctttctatgttcgataat
cctaaatttatgataacgggtacacctagtcttgtactgttcttcacaatctttacaaat
gcttacaagttaaggcaaactaattttacgttggactttctctgggttctttggagaaat
cctttaccgcaactttccatcatttctcatattatcctatccccaacatcgatgtttgat
ataagagagttcaatgtcaatcctgtagtttctgttgatagcttaaaggattatagcgaa
gagcttgttaattatgcgaaaatatatgaaaaaagtaatttaaattgcattgaacttgtc
caaatccttttacgcctgttatctgaggtagtcacctacgaaacttcactgttcttgaat
tttttggatgagaaagtttctgccgagcttttgcttttgggtacgctgcagctccctttg
gcatggaatcctgttcaagagtcattagcgtttcaatggtgttcagactttttttccaat
ttcaaagaacataaatttgtcttcgttaggattgaacgaacaaaccctcaatttttgttc
gcctttttacgcagtttgtggctgaaggatagttcatctgtgaatcaggtagtagagttt
attatcgaaaatgattttacatctcacatcggcaacattcaaccaaatcgatttgcttta
gagattgctgcacttgcagctgctcgcaaagcgttatcgtttcaggattggcttgacaaa
aagatgctcgaatttgaggatgcagacggacttaatgttttcttggtagaggttttggat
tttttgatgagtcgagcggcattacaaaaaaatgagtctgaacaaaaggaagagtctgtt
gttctttccatcgatacggttaatgttctattgacaacgttgatggacaacgttagtatt
tcggaggaagtcagtgaacatataaaagatgtccaaattttgtgtcttcaagtttatccg
cgtctcttcagtttgggtcatgatcgggatagcattgttattgctactaacacgactaat
tctttttcaccggatgtagaatcggaggtagaatcgtactttcaagctctgtatgaacga
cgcatatcaattgggaagattgttttgacgcttcaaaattttaaaaaatcggaaaacccg
cgtgaccttgatttgtttgcatgtttacagcatagtctttttgatgaatacaggtttttc
cctgactatcctttggaagcgttagctttgacagcagtcttgtttggaagtttgattcaa
tttgagcttctatcttttgttcccttaggtgttgctttgcgttacgtttatcaggcgctg
cttatgcccaccgactccaaaatgtttagatttggtatgcaagccttggttcagtttcaa
gaaaagctaccaaaatatattaactactgtaatcttatattgggtataccttctcttcag
ctagtgcgccctgatatatatgactctatcagagaaatgattgcgtctaatgaaaatact
gaagttgaaaaagataaactcgatagtttttctgctctcgctaatcctgcaagtccaaaa
gcgcctgagtatacattcgtttctatccatgttcctcctttaaatgtgccaaatgctgaa
ggtgaaattgaagagagcgtttgtgataacatcttatttgcaattaacaatctttctcag
cttaattttaatgaaaagttaaaagacgttaaggataatttgactcccgcatatttgcct
tggttttcgcattatattgttacacaacgtgttagtcgtgaagccaatttcttgtctctg
tatggaaagtttttagaggagttaaaatcaagtgatctctacaaaattgtttttcgggat
actcttcaagcaatattggatataatgaacaataacgcagagacattatcaccttcagag
aaaacaaaccttaagaacctaggttcgtggttaggaagtattactctattgcgcaacaag
ccaattacaacccttcaagtttcttttaaagatttactacttgaagggattgatagtggt
cgaattgatagagttttaccatttgtgtgcaaagtgcttgagaaagcttcttcatctgtc
atatttaaacctcctaacccttggttgatgggaattttgaagttactggttgagttgtat
cagtttgctgattttaggcttaacttaaaatttgaaattgagttattacttaataacttg
aatgtcaagatggacaacattgaaccttctgaaatgtatcgtaaccatcttgtccaaaaa
gccgatttagaaaaggagcttcctgaggacgtacttaacgctgagttccctgatggcacc
gatgttataacccaatatatagtagctgcatcttcgcaaataacagtaacggatgcggta
gctcaggtgtttggaaaacccaaacctgctataaaaaatattactcaattaataattcag
caatctgttttagaaataatttcagcagtagtgcgacgatctgttgggattgcagctatt
actaccaagagccttttacagaaggattttgcagctgaatcaaatccttcccgactttta
ttagccgctagacaaatggctaaaacccttgccggaaatttagcaatggttacttgtcgt
gaacctttacaaatgcttatgatcaataattttaggacgatagctttacaggacgttgaa
aacgttcatgctgctgtggcacaagcaattgatgagcttgttagtcaaaacttgttcgtc
gctagctctgtaatagagagtgtggcatcggagacggctattgctgaaattgacgcggaa
attgagcacatgatagtggagcgtgttcgacaccgtaagacaacaccaaatcttccattt
gttgatccagctggagcggctaatttacacttgaaccttcctagcgtattgaaattatcg
tcggagcttacgcctcaacaatttcaattatatgaaaattttgaccgcttgagcctatct
accataatgagtaacaattcttttaccagtcttaatggattacgtaccgacagtgccgac
agtacggacgctttgaactccaatcttaataatacagtcgagaatgaagctaatcagaca
gcattgaactacgctagaaatttgctcataattattgggcagttatttcagctggctgcc
caaatgccttataccagtatgcaggaggttccagctgatcatgaattacatgaactcgtt
aatcaatttttaactggcgttgcctctattaatcatcccattgcagatcacgtatttttg
ttatgcgctcaagaatgttgtcgcatacttctcaccgacagtaaatcacctttcattttg
gaagtgttttctgcaattttagagtatatttgtcaagcatccacaaaaactgcgataaat
gtctctttgtattggaacttctctaatgatcttgaaaagcttaatcttcctattattttg
agtttaattagatttggaattctcacgtctggtgaagttgattatcacgtagctagaggt
gtccggtctgaacaaggatctggtcctgttaccgattttgcaatagagttattgaggaca
gcggtaggtggtgagaatccaatggctttacctggtaattttgtgaattctatcacttca
ctctacgagattagtgaatctttctctggtgagacgaaacaggcctatgagcaacttgtt
gaaacaatgaacaagagtgtatcacctgcatctgaaattttgtctgatctcgataataaa
caacaacttaacgatcaaattataatcgtttttgtctcttgggttcatctgttgcgcaat
tcggcaaccaacgatgaaactaaagctgcatttgtataccaattgcataaacaaggaatt
ctgtcagagcctgagttatgtattcagtttttcagatgtaatttagaggcagttttagtt
gcctttttggaagcagcttccgttaatgcccccgattattttaatgttgacgcttatgcc
tctctattggtaaacgttgttaagtacactgaaggtagtactgaaggaacggtatcttca
aaaagcgtgctttttagaaagatcattgctttgataatcggtgtgtttgccgaattgcat
aattccatggctgaatttgtccatcaaaaaacatttttcagattgttctctagtatactc
tccgagcttgatgatgctaaggatgtattggagtcctgcttcgtcgatatctatagtgtt
attttagaatgcttccttgctattcagccacgctctttcccagcgtttacatttgcctgg
cttagccttatttcacattcatacttactaccgaaggttcttcttgtcaataatgataaa
attaatgatttatttagtgagatcctgatgtcctttttaaaatttttagatttgaaggat
gatattgataaagcccaatttaaacttctttataatggcttcttgaggatcatacttgtt
cttcttcatgatttccctggctttttggctacccattgttaccaattgataccttatatt
ccattagaatgcgtgcaacttcgtaatatggtattgagcgcgtttcctagtgatcttcat
cttcctgatccatttgctcaaggtttgaaggtaggcagattacctgaggtaacccgcgca
ccattaatttcaaattcagtttctgcttcacttgagaaatttgcgtcagcgttggattta
gaagcttgtttctcttcttccaaaccagcggaagttgccaagctattgttagaagtgtac
tcaagtcaagatacccctactaaattaaacgaatgggcaaactattttatgctttgttta
atacgccacgctactcgtgattcccctgccaagcaagccccacaatttcaatcaaaatct
cctgaatgtgtaattattagtactatgaatcgcagttgcgattcaaagtgccgctatttc
ttgttaactgcgattgctaatcagctgcgttaccctagcagccatacttactatgctagc
tgttgtttcttgtaccttttcaagagttcttctaacaaccctcaagaattgcttatcaaa
gaacagatgacaactgtacttttggaacgcataatttgcaatcgaccacatccttggggc
cttttaattacatttactgaattattaaaaaatgaagactataacttttggaaacaccct
tatataaagcgaaacgatgaaatctgtcgtttgtttgatagtctccatgaacatgtcatg
gcaccctcctcagctaataatgtctctaccgaagaggctacagaactgatgggtcaagtt
taa

DBGET integrated database retrieval system