KEGG   Schizosaccharomyces pombe (fission yeast): SPAC20G8.08c
Entry
SPAC20G8.08c      CDS       T00076                                 

Gene name
fft1
Definition
(RefSeq) putative protein Fft1
  KO
K14439  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 [EC:3.6.4.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC20G8.08c (fft1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPAC20G8.08c (fft1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    SPAC20G8.08c (fft1)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII ERCC3_RAD25_C
Other DBs
NCBI-GeneID: 2541983
NCBI-ProteinID: NP_593325
PomBase: SPAC20G8.08c
UniProt: P87114
Position
I:complement(join(1412062..1412214,1412262..1412792,1412836..1413237,1413276..1413410,1413449..1415062))
AA seq 944 aa
MKRKDNKELICIPSSSPPSTPIREENYYLLTSSPIECSPIQQLDLSGSFKNYSTTSSRAN
GKKFGQLAMQSRIFFDTTDHKKYVESSYAAYDPHDQPPERDVSLKESSNKINPSNFFDSE
QITKINAVKKRFPALDSEMIIATLEKFNWRENITIHKLTFQKLLGRGNSTINKSAQKLNN
QPIEKSSVDKENAKRKRYVEEGTKQGQKKKPLRVIELSDEETNEDDLLGQSPTACTTDAN
IDNSIPENSDKIEEVSIESSGPSEVEDEMSEYDVRVLNFLNESTLQEIVEVSGCESKVVE
YFISKRPFPSLEKAEALCQRNAHAATGKRKKSDGRNVGRKLVNSTYEVLQGFDAVDSLIA
KCERYGAMISNTMRSWHNLFDDKKMEQFLNTSTGSISYEYNSQQPSSIASGITLKSYQIV
GLNWLCLMYKAKLSGILADEMGLGKTCQVISFLASLKEKGIQNRHLVVVPSSTLGNWLRE
FEKFCPSLRVESYSGTQSERINKRYYLMDTDFDVLVTTYQLASGSRDDRSFLRKQRFDIS
IFDEGHYLKNRMSERYKHLMNIPANFRLLITGTPLQNNLKELISLLAFMLPKVFDNNMQG
LDIIYKIKTTSDGDIERAYLSQERISRAKTIMNPFILRRRKENVLSDLPPKIQHVEYCHM
EETQLSLYLSVLELKNLVNANRENILMQLRKAALHQLLFRSQYNLETLSLMSKRILREDA
YLDANPQYIFEDMEVMSDFELHKLADQYRHLHPFALKGKPWMDSAKVKKLCSLLKKSRPN
ERILIFSQFTQVLDILEYVLNTLDLEFLRLDGSTPVETRQQLIDDFHTNENYKVFLLSTK
SGGFGINLTCANIVILFDCSFNPFDDMQAEDRAHRVGQTRPVHVYRLITKNTIEENIRRL
ANTKLTLESSLTTDSEKIQKEISGELMKSLQMDGRVDTMDGSVV
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgaagagaaaagataataaagaattaatttgcataccaagctcttcacctccttcaact
cctatacgcgaagaaaattattatttgcttacgagctctcccattgaatgtagtcctatt
caacaattagacctgtcaggaagtttcaaaaattattcaactacctcctcaagggctaac
gggaaaaaatttgggcagttggctatgcaatctcgtattttttttgacacaaccgatcat
aaaaagtatgttgagagcagctacgcggcgtacgatcctcacgatcagcctcctgaacgc
gatgtgagtttaaaagaatcttcgaacaaaataaacccctcaaacttttttgacagcgaa
caaattacgaaaattaatgctgtaaaaaaacgatttccagccttagattcagaaatgata
attgcaacattagaaaaattcaactggagggaaaacataactatccataagcttacgttt
cagaagttgctaggacgaggtaactcgacaatcaacaagtcagcccaaaagctgaacaac
cagcccattgaaaagtcctcggtagacaaggagaacgcaaaaaggaaacgttatgtagaa
gaaggaactaaacaagggcaaaagaaaaagccgcttcgtgttattgaactttcagatgaa
gaaacgaatgaagatgacttgttaggccaatcacctacagcgtgtactacagatgctaac
atcgataattctattcccgaaaattctgataaaatagaggaagtaagcatcgaaagttca
ggaccttcagaagttgaggatgaaatgtctgaatatgatgttcgagttttaaacttttta
aatgaatctacacttcaagaaatagtagaagtttccggttgtgaatcaaaagtggtggaa
tattttatttctaaacgaccatttccttctttagaaaaagcagaggcactatgccaacga
aatgcgcacgcagccacaggtaaacgaaagaaatcagatggccgcaacgttggaagaaaa
ttagttaattcaacttatgaagtacttcagggattcgatgctgttgactctctgattgct
aaatgcgaaaggtacggggctatgatatccaatactatgcgatcttggcacaatttgttt
gatgataaaaaaatggaacagtttcttaatacttctacagggtctatcagttacgaatac
aatagtcaacaaccatcttcaatcgcatctggtataactttgaaaagttatcagattgtt
ggactcaattggttgtgtttgatgtacaaagcaaaattgtcagggattttagctgatgaa
atgggtctaggaaaaacatgtcaagtgatttcatttctagcttcgttaaaggagaaaggt
atacaaaatcgccacttggtagttgttccatcttctactctcggaaactggttgcgagaa
ttcgaaaagttttgcccgtcgcttagagtagaaagctattcgggaactcagtcggaaagg
atcaacaaaaggtactacttaatggatacggattttgatgttctagttactacttaccaa
cttgcatctggaagtcgagacgacagatcattcttaaggaaacagagatttgatatttct
atatttgatgaagggcattatttaaaaaatagaatgtcagaacgatataaacacctgatg
aatattccagcgaattttcggctactcatcactgggacaccgcttcaaaataatttaaag
gagttaatttcccttttagcctttatgctacctaaagtatttgacaataatatgcaaggc
ttagacatcatttacaaaataaaaacgacttcagatggcgatattgagagagcttatctt
tctcaagaaagaatatctcgtgctaaaacaattatgaatccatttattttaagaaggaga
aaagaaaatgtactttcagatttacctcctaaaatacagcatgtcgaatactgtcatatg
gaggaaactcaactctcattatacctatcagttttggaattaaaaaatttggttaatgct
aatcgggaaaacattctaatgcaattacgaaaggccgctcttcaccagttgctctttcgt
tctcaatataatttggaaactctatcgttaatgtcaaaaagaattttacgggaggatgct
taccttgatgcgaatccgcaatatatttttgaagacatggaagtcatgtctgattttgag
ctgcataaacttgcagatcagtatcgacatctgcacccttttgctttaaaaggtaaacct
tggatggattctgctaaagttaaaaaattgtgcagcttgctgaaaaagagtcgtccaaat
gaaagaattttgatttttagtcagtttacccaagtgctggatatccttgaatacgtgctt
aataccctggatcttgagtttttacgcttagatggtagtactcctgtagaaactaggcaa
cagttaatcgatgattttcatactaatgagaattacaaagtttttcttttgtctacaaaa
tcaggaggatttggaattaatttaacatgtgctaatattgtaattctttttgattgctcc
ttcaatccatttgatgacatgcaggcagaagaccgagcacatagagtcggacaaacgcgg
ccggtgcatgtttacaggctaattacgaaaaacactatagaagaaaatattcggagattg
gctaatactaaacttactctcgagtctagcttaaccacagattctgaaaaaattcaaaaa
gaaatttctggagagctaatgaaatctctgcagatggatggacgggtggatactatggat
gggtccgttgtttag

DBGET integrated database retrieval system