KEGG   Schizosaccharomyces pombe (fission yeast): SPAC222.11
Entry
SPAC222.11        CDS       T00076                                 

Gene name
hem13
Definition
(RefSeq) putative coproporphyrinogen III oxidase
  KO
K00228  coproporphyrinogen III oxidase [EC:1.3.3.3]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00860  Porphyrin and chlorophyll metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01240  Biosynthesis of cofactors
Module
spo_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPAC222.11 (hem13)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.3  coproporphyrinogen oxidase
     SPAC222.11 (hem13)
SSDB
Motif
Pfam: Coprogen_oxidas
Other DBs
NCBI-GeneID: 2541934
NCBI-ProteinID: NP_593150
PomBase: SPAC222.11
UniProt: Q9UTE2
Position
I:966430..967368
AA seq 312 aa
MSDITVEPIGKQMEKLILDVQQEIVAGLEAVDGQKFFQDKWTKGEGGYGISCVIQDGNVF
EKGGVNTSIVQGKLNQDAVQRMRANHEGIDRTAKELPFFAAGISMVIHPRNPMAPTTHLN
YRYFELVNSDGKKIWWFGGGADLTPSILFEEDGKHFHKLHKEACDRHDPTFYPRFKKWAD
EYFLIKHRKETRGIGGIFFDDLSEKDPQELFAFVKDCAHTFLPAYVPIMEKRKNMEFTED
DKEFQLIRRGYYAEFNVMYDRGTWFGLQAPEPRVESILMTLPLHASWRYKYEPKQERHKA
LLKVTHTPIEWC
NT seq 939 nt   +upstreamnt  +downstreamnt
atgtctgacattaccgttgagcctattggcaagcagatggagaagcttattctcgatgtt
cagcaagaaattgttgctggtctcgaagctgtcgatggacaaaaattcttccaagacaag
tggaccaagggagaaggtggttatggtatcagttgtgttattcaagatggcaacgttttt
gaaaagggtggtgtcaacacaagtattgttcaaggaaaattgaatcaagacgctgtccaa
agaatgcgtgctaatcatgaaggtattgatcgtactgccaaagagcttccattctttgct
gctggtatcagtatggttattcaccctcgcaaccccatggcccctactactcacttgaac
tatcgttactttgaacttgtaaacagtgatggtaagaagatttggtggtttggtggtgga
gccgatttgactcctagcattctctttgaagaagatggcaagcatttccacaaattgcat
aaagaagcttgcgatcgccatgaccccactttctatcctcgcttcaagaaatgggctgat
gaatacttcctcatcaagcacagaaaggagactcgtggcattggcggtattttctttgat
gatctttctgagaaagatcctcaagagttatttgctttcgtcaaggattgtgcccatacc
ttccttcctgcctatgtccctattatggaaaagagaaagaacatggaattcactgaagat
gataaggaattccaactcattcgtcgtggatactatgccgagtttaacgttatgtatgac
agaggtacttggtttggtcttcaagctcctgaaccccgtgttgaatctattcttatgacc
cttccattacatgcttcctggcgttacaagtatgagcctaaacaagagcgtcacaaggct
ctccttaaagtaacgcatacccctattgaatggtgctag

DBGET integrated database retrieval system