KEGG   Schizosaccharomyces pombe (fission yeast): SPAC227.07c
Entry
SPAC227.07c       CDS       T00076                                 
Symbol
pab1
Name
(RefSeq) protein phosphatase regulatory subunit Pab1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03015  mRNA surveillance pathway
spo04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    SPAC227.07c (pab1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPAC227.07c (pab1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spo01009]
    SPAC227.07c (pab1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPAC227.07c (pab1)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC227.07c (pab1)
Protein phosphatases and associated proteins [BR:spo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     SPAC227.07c (pab1)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     SPAC227.07c (pab1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     SPAC227.07c (pab1)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 2541519
NCBI-ProteinID: NP_592961
PomBase: SPAC227.07c
Ensembl: SPAC227.07c
UniProt: Q12702
Position
I:complement(507522..509960)
AA seq 463 aa
MDDIEDSLDQWKFAQCFGDKGDVEDITEADIISAVEFDHTGDYLATGDKGGRVVLFERNH
SKKGCEYKFFTEFQSHEPEFDYLKSLEIEEKINKIRWCKRTNRAHFLLSTNDKTIKLWKL
YEKNLKVVAENNLSDSFHSPMQGPLTTPSQLRLPRLNHHDMIIAAYPRRVYANAHAYHIN
SISVNSDAETYISADDLRINLWNLSISDHSFNIVDIKPENMEELTEVITSAEFHPINCNH
LMYSSSKGNIKLLDLRQSALCDNPCKLFEDQEDQDSKSFFSEIISSISDVKFSQNGRYIL
SRDYLTLKIWDVNMEKAPVKTIPLHDVLRSKLCDLYENDCIFDKFECTFSGDDKHVLSGS
YSNNFGIYPTDSSLPGDRGQIVLQADKAAFRARKSAANNVPKLNAVKNNDWRSQPQAAMG
SASVGLDPDNLDYNKKILHASWHPFEDSVAIAATNNLFVFSKL
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggatgatatagaagactctttggatcagtggaaatttgcccaatgctttggtgacaag
ggtgatgtggaagacatcactgaagccgatatcatttcagcagtagaattcgaccacaca
ggtgattatctagcaaccggcgataaaggtggcagagtcgttctttttgagcgaaatcat
tcgaaaaagggttgtgagtataagttttttactgaatttcaaagtcatgaacccgagttt
gattatctcaagtccttagaaatcgaagaaaagatcaataaaattcgctggtgcaagagg
actaatcgagcgcattttttactctcaacgaatgataaaactataaaattgtggaaacta
tatgaaaagaatttgaaagtcgttgccgaaaataatttgtcggacagtttccacagtcct
atgcaaggacctttgacaacaccttcgcaacttcgactcccacgactcaaccatcatgac
atgattatcgctgcatatccacgacgtgtttacgctaatgcacacgcatatcatattaat
tcgattagcgttaactctgatgcagaaacttacatttccgctgatgatttacgtatcaac
ttatggaacttgtccatctccgatcattcattcaacatagttgacattaaacctgaaaat
atggaagaacttacggaagttattactagtgccgagtttcacccgataaactgcaatcat
ctcatgtatagtagcagcaagggaaatatcaaactcttagatttgcgtcaatctgcgctc
tgcgataatccatgtaagcttttcgaggatcaagaagatcaagattccaagagtttcttt
tctgaaatcatctctagcatttcagacgttaagttctcacaaaatggccgctatattctt
tcaagagattatttaactcttaagatatgggatgtcaacatggaaaaagctcccgttaaa
actattccattgcatgatgttttgcgatcaaagttatgcgatctctatgaaaatgactgt
atttttgataaattcgagtgtaccttttctggtgacgacaaacacgttttatcaggaagt
tatagcaacaactttgggatttaccccacagatagttctttgcctggcgatagaggacag
atagttttgcaagccgacaaggctgcatttagagccagaaaatctgctgcaaataacgtt
ccaaagttgaatgctgtgaaaaataatgattggcggtcacaacctcaagctgcgatggga
tctgcttctgttggccttgatcctgataacctggattacaataagaagatattacatgcc
agttggcatccctttgaagactcagttgccatcgccgctactaataatctttttgttttc
tctaagctctaa

DBGET integrated database retrieval system