KEGG   Schizosaccharomyces pombe (fission yeast): SPAC22A12.17cHelp
Entry
SPAC22A12.17c     CDS       T00076                                 

Definition
(RefSeq) short chain dehydrogenase (predicted)
  KO
K17742  sorbose reductase [EC:1.1.1.289]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00051  Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPAC22A12.17c
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.289  sorbose reductase
     SPAC22A12.17c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase DUF3455 3Beta_HSD PA
Motif
Other DBs
NCBI-GeneID: 2541844
NCBI-ProteinID: NP_593247
PomBase: SPAC22A12.17c
UniProt: O13908
Position
I:complement(1188325..1189110)
Genome map
AA seq 261 aa AA seqDB search
MVAPAHNYESRNILDLLSLKGKNAVVFGGARGIGHAICSVFAEAGANAFIVYNTTPGEKA
AKEIAQANGVKTYTCKCDVTIPKEVEHAFAEIQKVFDTIDIVVPNNGICTGKSAIDMTYE
EFANEINVNLLGVFNVAHNAGPIFQKQGHGSLVATASMSGVVVNVPQQQCAYNTSKAGVI
QLIKSLAVEWRKFARVNCVSPGYTTSDMTGGKFHKEWEPYTPFERNGLAKEIASAYLYLA
SDAASYASGTNLIVDGGYTSI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggtcgctcctgctcataattacgagtctcgcaatatcttagatctcctttcattaaag
ggaaaaaatgctgtcgtctttggcggtgcccgtggtattggtcacgctatctgctcagtg
tttgctgaagctggcgccaatgcctttatcgtctataacaccactcctggcgaaaaggct
gcaaaggaaattgcccaggctaatggtgtcaagacttatacatgcaagtgcgatgtcact
attcctaaagaggtagaacatgcctttgctgagattcaaaaggtctttgatactattgat
atcgttgtgcccaacaacggtatttgcactggcaagtccgccattgacatgacttacgaa
gaatttgctaatgaaataaacgtcaacttgctcggtgtcttcaacgtcgctcacaatgct
ggccccatcttccaaaagcaaggccatggcagccttgtagctactgcttccatgtctggt
gttgttgttaacgttcctcaacaacaatgtgcttacaacacttccaaggccggtgtcatt
caactcatcaagagtttggcagtcgaatggcgcaaatttgctcgcgtcaactgcgtttct
cccggttacactactagtgacatgactggtggtaagttccacaaggaatgggagccttat
actcctttcgagcgtaatggtttggctaaagagattgcttccgcttatctttatcttgct
agtgatgctgcttcatacgcttccggtaccaacttaatcgttgatggtggatataccagc
atctaa

DBGET integrated database retrieval system