KEGG   Schizosaccharomyces pombe (fission yeast): SPAC22E12.10c
Entry
SPAC22E12.10c     CDS       T00076                                 

Gene name
etp1
Definition
(RefSeq) cytochrome oxidase cofactor Cox15/type I ferredoxin Etp1 protein etp1
  KO
K02259  cytochrome c oxidase assembly protein subunit 15
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00190  Oxidative phosphorylation
spo00860  Porphyrin and chlorophyll metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPAC22E12.10c (etp1)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPAC22E12.10c (etp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPAC22E12.10c (etp1)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    SPAC22E12.10c (etp1)
SSDB
Motif
Pfam: COX15-CtaA Fer2
Other DBs
NCBI-GeneID: 2541839
NCBI-ProteinID: NP_594836
PomBase: SPAC22E12.10c
UniProt: Q10361
Structure
PDB: 
2WLB

Position
I:complement(join(5037208..5037446,5037492..5039103))
AA seq 616 aa
MNISRSSGLMRQFLLQPLRKGCDISCLGRSSWRMSRSFSGSSVLNEINLSRTKNLFLNDC
KFNKNSFEKFFARRLSNSVAPTPGGILQETEKIPSKKVAFWLLGSSALVLAIVVVGGITR
LTESGLSITEWKPITGVIPPLTDEQWNQEFELYKKSPEFEKLNSHMTVDEFKNIFFWEWF
HRVLGRGIGLTILLPSIYMIVTKRASPWLSKRLIGLTGLVGLQGVIGWWMVKSGLSEELF
SDGSHPRVSHYRLATHLAAAVALYIGLVWTGHGILQRHAFLKSMKSGSTSQLTSMVSSVQ
KMKGFRTSVNSFVGLVLITLLSGAFVAGLDAGMIYCTFPEMGEGRLAPSKSELFDQRFCR
KDDKSDLIWRNMIDNPSLVQLEHRILAITTFVAACGLFIFSRAKRNILPKKIKTSINVVT
GVVTAQATLGIMTLIYVVPVPLAALHQAGSLVTLTAALSLAQRLHPEYALKNIRSWTKLI
SSPPKSSISSSILTQQRQFHTFRPSFHSEIKKPLPGTGIKVFFVTPEGREIMIEGNEEGA
CEGSVACSTCHVIVDPEHYELLDPPEEDEEDMLDLAFGLEETSRLGCQVLLRKDLDGIRV
RIPAQTRNIRLERPKA
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgaacatttcacgttcatcaggtctgatgagacagttcctgcttcagcccttacggaaa
ggctgcgacatttcttgccttggaaggtcaagttggagaatgagcaggagcttctctgga
tcgagtgttttaaatgaaattaatttgtcacggactaagaatttatttttgaatgattgt
aagtttaataaaaattcatttgaaaagttttttgctcgccggctgagtaactcagtcgct
cctacaccaggtggcatcctacaggaaaccgaaaaaattccgagtaaaaaggtcgccttt
tggctgcttggatcttctgctcttgttcttgcaattgttgttgtaggtggcattactaga
ctaactgaatccgggttaagtattactgaatggaagcccatcactggcgtaattcctcct
cttactgatgaacaatggaaccaagaatttgagctttacaaaaaatcaccagagtttgag
aagctgaacagccatatgacagtggatgagtttaaaaacatatttttctgggagtggttt
catcgtgtcctcggtagaggaatcggcttgacaatccttcttccttccatatacatgatt
gtgactaaaagggcatctccttggctaagcaagcgactaatcggccttacgggactcgtt
ggacttcaaggagtcatcggttggtggatggtcaagagtggtctttcagaagagctcttc
agtgatggttctcatccgcgtgttagtcattatcgcttggctactcatttagccgctgcc
gttgctctctatattggcttggtgtggactgggcatggaatccttcaacgacatgccttt
ttgaaatctatgaagagtggctccacatctcaattgacttcaatggtttcttcagttcag
aaaatgaaaggatttcgtactagtgttaactcatttgttggcttggtactgatcaccctt
ttgtccggtgcctttgttgctggattggatgccggaatgatttattgtactttcccggaa
atgggcgaaggaagacttgctccatctaaaagcgagttatttgatcaaaggttttgtagg
aaagacgacaagtccgatcttatatggagaaacatgattgacaacccaagtcttgttcaa
ctcgaacaccgtatcttagctattactacttttgttgctgcatgtggtctttttattttt
tcccgtgctaaaagaaacattttgcctaagaagattaaaactagcattaacgttgttaca
ggcgttgtaactgctcaagctactttgggtattatgactctaatctatgttgtccctgta
cctttggcagcccttcatcaagccggtagtcttgttacattaaccgcggccttatcactt
gctcagcgcttgcatccagaatacgctttaaaaaacatccgctcatggacaaaattaatc
tcttctcctcccaaaagtagcatttcatcttccattttgactcaacaacgccaattccat
acattccgcccatcattccattccgaaattaaaaagcctttgccgggcactggaatcaaa
gtttttttcgtcacgcctgaaggacgtgaaatcatgattgagggaaatgaagaaggcgct
tgtgaagggtctgttgcatgttcgacttgccatgttatcgtagatccagagcattacgaa
cttttggatcccccggaagaagatgaagaagacatgcttgatttagcatttggtcttgag
gaaacaagcagattgggatgccaagtactcttaagaaaagatttggatggcatccgtgta
cgaattcctgctcagactagaaacatacgattggagagaccaaaagcttga

DBGET integrated database retrieval system