KEGG   Schizosaccharomyces pombe (fission yeast): SPAC22E12.14c
Entry
SPAC22E12.14c     CDS       T00076                                 

Gene name
sck2
Definition
(RefSeq) serine/threonine protein kinase Sck2
  KO
K08286  protein-serine/threonine kinase [EC:2.7.11.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPAC22E12.14c (sck2)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     SPAC22E12.14c (sck2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like APH Adeno_E3_15_3 FTA2 Kdo
Other DBs
NCBI-GeneID: 2541867
NCBI-ProteinID: NP_594840
PomBase: SPAC22E12.14c
UniProt: Q10364
Position
I:complement(5046577..5048517)
AA seq 646 aa
MMNKWAKNWFGLSKKSVSTNSAKGSLPRSPLASIQTNQPVEEGEGGSLPSVSNLGPSSID
HPMEEFASDQSTVGNRNSNDILPEVDHEPSGYLKLQIGSLVLGGPHTDAALAMECSRLNQ
LFVVVQFGTTEFVSPPLKWESPGRDIGTSSRDSANVSRSSSMMSSHPIPTPAIQRTSSIP
NPLTPSYVVFDVAKPVPIDVNIYDHGNNNEFVGRTYIHPSYNYGQFEQFCNSVEVSPAYN
RMVDLRLSLNTVFQPLSQHSYGPDDFVPLKLIGKGTFGQVYLVRKKDTERVYAMKVLSKK
VIVRRKEVAHTVGERDILVQTSAADSPFIVALRFSFQTPKDLYLVTDYMAGGELFWHLQK
SVRFPEERAKFYIAELLLALQALHKRGIVYRDLKPENILLDVQGHIALCDFGLSKANLSV
GTTTRTFCGTTDYLAPEVILDEAGYDMMVDFWSLGVLLYEMTCGWSPFYADNTQQLYKNI
VFGKVRFPRGLLSVEARDLIKLLLNRNPKHRLGAHGDVEEVMKHPFFDGIDWKKLAAKEI
SPPFKPIVEGEIDVSNFDVEFTNKAIDRDFSSTDEMSTSAPLSSTVQNGFKGFTYIDASA
MDEAFGYHNSNDSASSISSQDDYSKDNSDMDLNRANDEVFMGQIDP
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgatgaataagtgggcaaaaaattggttcgggctgtctaaaaaatcggtttccaccaat
tctgctaaagggtcacttccccgaagtcctttggcaagcatccaaaccaatcaaccagtt
gaggaaggtgaaggtggttcacttccttcagtttcaaatttaggtccttcctcgatagac
catcccatggaagaattcgccagtgaccagtctacggttggtaacagaaatagtaatgat
atattacctgaagttgaccatgaaccttcaggctatttgaaacttcaaataggttcatta
gttttgggaggacctcatactgatgcagcattagccatggaatgctcaagacttaatcag
ttgtttgttgttgttcaatttggtacgacggagtttgtttcacctccattgaaatgggaa
tcacctggccgtgatataggcacatctagtcgggattctgctaatgtgagtaggagttca
tctatgatgagctctcatcccattcctactcctgcaattcaacgtacgtcttcaattcca
aatcccttaactccatcttatgttgtatttgatgttgctaaaccggtccccatcgatgtt
aatatttatgaccatggtaataataatgaatttgttgggagaacttacattcacccgtct
tataattatggtcaatttgaacagttttgcaacagcgttgaagtttctcccgcatacaac
cgtatggttgatcttcgtctttctctcaatactgttttccagcctctcagtcaacactcc
tacggccctgatgacttcgttccgttgaaattaattggaaaaggtacatttggtcaagtc
tatcttgttcgtaaaaaagacaccgagcgcgtatacgcaatgaaagtactttccaaaaaa
gtaatagtccgtcgcaaagaagttgcacacactgttggggaaagagacattctcgtccaa
acttctgcagctgattcgcccttcatcgttgctttacgtttctcttttcagacccccaaa
gatttatatttggtgacagattatatggctggaggcgaattattttggcaccttcaaaaa
tcggtacgatttccagaagaaagggcaaaattctatattgccgaattgttgcttgctttg
caagcgttgcataaacgaggaattgtatatcgggatttgaaacctgaaaacattcttttg
gacgttcaaggacatattgccttatgtgatttcggtttgtcaaaggccaatctttcagtg
gggactactacacgtacgttttgcggtaccacggattatctagctcctgaggttatttta
gacgaagcagggtatgatatgatggttgacttctggtctttaggggtacttttgtacgag
atgacatgtggctggagccctttctacgctgataacacacaacaactttacaagaatatc
gtgtttggtaaagtccgttttcctagagggttgctatctgtagaagccagagatttgatt
aagctattattgaatcgtaatccaaagcataggcttggtgcacatggggatgttgaagag
gtaatgaagcatccattttttgatggaattgattggaagaaactcgctgcgaaagaaatt
agtccaccatttaaaccaatagtggaaggtgaaatagatgtttctaattttgatgtcgag
tttacaaataaagcaatcgatagagactttagtagcacagatgaaatgtcgacctctgca
cctttatcatcaactgtccaaaatgggtttaagggttttacctatattgacgcaagtgct
atggatgaagcattcggataccacaactcaaatgattctgcttctagtatttccagtcaa
gatgattattctaaggacaattccgatatggacttaaatcgtgcgaacgatgaggtattt
atgggacaaatagatccataa

DBGET integrated database retrieval system