KEGG   Schizosaccharomyces pombe (fission yeast): SPAC22E12.17c
Entry
SPAC22E12.17c     CDS       T00076                                 
Symbol
glo3
Name
(RefSeq) putative ARF GTPase-activating protein
  KO
K12493  ADP-ribosylation factor GTPase-activating protein 2/3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    SPAC22E12.17c (glo3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC22E12.17c (glo3)
Membrane trafficking [BR:spo04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    SPAC22E12.17c (glo3)
SSDB
Motif
Pfam: ArfGap
Other DBs
NCBI-GeneID: 2541825
NCBI-ProteinID: NP_594843
PomBase: SPAC22E12.17c
UniProt: Q10367
Position
I:complement(join(5053107..5054373,5054436..5054554,5054608..5054673))
AA seq 483 aa
MTATKEESQKLLTSLRSQRDNKVCFDCGAKNPTWSSTTFGIYLCLDCSAAHRNMGVHISF
VRSTVLDSWTYAQLRVMRVGGNENARNYFKRHGGVSLLNSKDCRLKYSSKTAKQYLEKLK
SLAVEDEANYPDILDMDFLSNTHEGSSAADTTNEDDDFFSAWDKASVKKSDDNLDDKTDL
ASTSSSVVVESGEKDEPVVVTEEKTMVSPPSRPDSTSTTKSKTSSISSARARPIRASSRP
TASKLGASRPQKLGIKKANADIDFDEFEKAVLSSESAPTKKPAAVASKESTVDTLVDNGV
EEVKESTSTTVQGKPVKPVLKSAASAKSTKSDDSNLNANFARLGFGQFAAASNARAKAAA
KARELKKNEVNAPTYARDHFASQKSISSDQYFGRGSFDPEAAAEAQERLSSFRDATAISS
KSYFGEEEDENEEGESSHRPDSAYLRDIAETATEDIEAIKVAIHQGAEKLSDFIQKVGAR
YNF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgactgctactaaggaagaatctcaaaaattgcttacatctttacgctctcaacgggat
aataaggtttgctttgattgcggtgccaagaatccaacatggagctcaacaacgtttggt
atatatctttgtctagattgcagtgctgctcatagaaatatgggtgttcacatatcgttc
gtaagatccacagtccttgattcttggacatatgcgcaacttcgtgtaatgcgggtcggt
ggcaatgaaaacgcccgtaattactttaagcgtcatggtggggtttcacttctgaattcc
aaggattgtcgtttgaaatattcttccaaaactgcaaaacaatatcttgaaaaactaaag
tctcttgcggtagaagacgaggctaattatcccgatatattggatatggatttcctttcc
aacactcatgaaggcagttctgctgctgacactactaatgaagatgatgactttttttct
gcttgggataaagcatctgtgaagaaatcggacgataatcttgatgacaaaactgactta
gcttctactagttcatcggtagttgttgaaagcggcgagaaagatgagcctgtcgtcgtc
actgaagagaagactatggtttctcccccttctcgtccagattctacttccactaccaaa
tcaaaaacttcttctatttcttctgctcgtgcccggcctatccgtgcttcctcacgccct
actgctagtaaattgggtgctagtagacctcagaagctcggtatcaaaaaggcgaatgcc
gatattgacttcgatgagttcgaaaaagctgtattgtcttccgaatctgcgccaaccaaa
aaacctgctgctgttgcgtctaaggaaagcaccgttgatacattggtagataatggagtc
gaggaagtcaaggagtccacttcgaccactgtgcaaggaaagccggtaaaacctgttttg
aaatctgctgcatccgcaaagtcaactaagtctgacgactcaaacctcaatgcaaacttt
gcacgtttgggattcggccagtttgctgctgcatccaatgcgcgtgctaaggccgctgca
aaggcacgagaactgaagaaaaatgaggttaatgcaccgacatacgcacgagatcacttt
gcttctcagaagtctatttcatctgatcaatattttggtcgtggatcgtttgatcccgag
gcagctgccgaagctcaagaacgtttatcttctttccgagatgccacagctatttcttcc
aagtcctattttggtgaggaagaagatgaaaacgaggagggtgaatcgtctcatcgtcca
gatagcgcataccttcgtgatatagctgaaactgctactgaagacattgaagctattaaa
gtagctattcaccaaggcgcagaaaaactttcagattttattcaaaaagttggtgctcga
tacaatttttaa

DBGET integrated database retrieval system