KEGG   Schizosaccharomyces pombe (fission yeast): SPAC22E12.18
Entry
SPAC22E12.18      CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: GCIP SYCE1
Other DBs
NCBI-GeneID: 2541850
NCBI-ProteinID: NP_594844
PomBase: SPAC22E12.18
UniProt: Q10368
Position
I:join(5055181..5055217,5055257..5056230)
AA seq 336 aa
MSDTMVKNQAEEDEIVKSLNNVLKIVVTARKCLDDMKPIELPSELVESPLSMLKDVATLI
HQYTTKLSVAAKPPITRDALEKYANDMATTITPLIAAVQVFNAEKYGEIIQNRLKMYAER
VLFGIEALLRSVSPKPLGYISEDWKTRGRLIDTGILWESCEKIEKLGSEGIVGYMLEEWD
NFVSMLEDARSDLEDYKEGDDSNWDDFGSESEDDSKEAHSEEVFRSEEQIQLANSLLQKL
NACKILFLSIKKRRIKNEYPNTFLGELFNAAKQTSDSIDDIVAQIQEDDENFENELDNFH
RSARNLCKICISSAQEDSFTPWFSKWLENWEIVSQK
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgtctgacactatggtaaagaatcaagcagaggaagatgaaatagtgaaatccttgaat
aatgttttaaagattgtagtcactgctcgaaaatgtctggatgatatgaagcccattgaa
ttaccttccgaattagttgaaagccctctttctatgcttaaagatgttgccactttaatt
catcaatatactacaaaactttctgtagctgcaaaaccgcccatcactagagatgcactt
gaaaaatatgctaatgatatggctacaacgattactcctttaattgcagctgttcaagta
ttcaatgcagaaaagtatggagaaattattcaaaatcgactcaaaatgtatgccgaacgc
gtcttatttggaattgaagcactgttacgaagcgtatctcctaaaccgttagggtatata
tcagaagattggaagacaagaggtagattaatagatactggaattttgtgggagtcttgt
gaaaaaatagaaaaattggggtcggaaggaatagttggttatatgcttgaagaatgggat
aattttgtctcaatgcttgaagatgctcgtagtgacttagaagattataaggagggagac
gattcaaattgggatgattttggtagtgaaagtgaagatgactcaaaagaagcacattcg
gaagaggtttttcggtcagaagaacagattcaactcgccaattcgttactacaaaagctt
aatgcttgcaaaattttatttctttctataaagaagagaagaataaaaaatgaataccct
aacacttttttgggtgaactttttaatgctgccaagcagacttctgattcaatagatgac
attgtggcacaaatacaagaggacgatgaaaattttgaaaatgaacttgataattttcat
cgttctgctagaaacctttgcaaaatttgtatctcttcggctcaagaagattcctttact
ccttggttctctaaatggctggagaattgggaaatagtatctcaaaaataa

DBGET integrated database retrieval system