KEGG   Schizosaccharomyces pombe (fission yeast): SPAC22F3.04
Entry
SPAC22F3.04       CDS       T00076                                 

Gene name
mug62
Definition
(RefSeq) putative AMP binding enzyme
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-GeneID: 2541797
NCBI-ProteinID: NP_593037
PomBase: SPAC22F3.04
UniProt: Q09773
Position
I:complement(join(698033..698177,698223..698441,698480..698841,698884..699104,699148..699363,699410..702533))
AA seq 1428 aa
MKPSENEKIHPVRHSKYEDKSKLPFETIPDPVLKYVKRARDAELQPQLAKVSQKLFADIS
TATAAEKLQFTVPRRARFEINDPRNPTFSMMALQDIISVLEYRRNKNPTSTAHICIDKKG
KEAVSYSWDKILNRAKQFASVAQNHVGLKPGTRVILYYRKSEASEYIISIFGCLLLGIVV
IPLSPSSSSESLKLVVNEEKVRVAFTTEATYRIFIKDTEVNNAKSLAWWKSNDFTNYKFE
QIKQYRMRANDTVLIDYTFSSSTYNDIKAVYTTKTFLSQMRNLTSSMITNPARQAGWKLH
NFEDSKDVLITNFHPSMPLGLIMGVFNSVFAGYCTIFCDEEVLKTPGLLAYLITKYRCTY
SLFDYAGLKQTVYNYQEDPKSTLSFKKNYTPNLSSLKLCMVECEVVDPEFNIIVSDRWLQ
PLGTNNSKEVITPILCLRKFGGIPISFKDWMISYTNRQKHERQMADTCYQEILVLKSSIE
KEKVEIVPFLDIRKYSPNEVLCMSPFWYPIPEASVAVVNEDSKNICKVGEVGEIWVYSDC
LPKLKAASVINNPQGEQLTDYENNQENKFEKNNSFMDSGLKGFLHNEKIFVLGNKDEQIR
QYRKTMVADKLMEEKYVHYSHYLIKKIMKYVPEIFDGVAFEIEIDKAVYSVLVLESPIIK
RSLIRNNRLKGRDLFSELVKITESSFQVTQDIFKLDVLSILIAPYKSLPRSRYMGIQAIN
TNKCKLAFLSGNLPVSYVRFFMDSALPKSKINLNNSKGIWSKDASKHHREIISLNVKQKM
DPYKHQNKVSKARENLLNHFTILDFLKTKSAKTPTSPAILTFNAIEKTKVELTWAHFELK
VASHVEYMQLSVKAKARSHILLLYYDPLEFLISIHSCFHLGVIPIPFQIREISQLIGEIE
EFTKIAKAFNVEAILVDHKVLISLKSRDISNHFQQTCIDLNMKAPKIFETTGIPISKRAK
KALNLITPGELNNKGKVALISINKLEDGSIIPTQFSHSSLLAFCHEQKEFVIGNEEKPII
GGIEFSSGMGLLHTALLGVYAGVPTLLIKQENLCNNGSLLFEAIEQNSLSKVMIPLNICQ
KSFSTAQGCNSIVINSTLSSIIVPCYDRPISSRVNSIIEDIARIGLAPNKVKLAYSHPIN
PFVCWNADSSMEKMKDYFDANQLRSGLVNVREDVLRNRQPLLYGSGTSTLYNEICIVHPE
EKYICQEGEIGEIWINGKHGSYCENNELNSGCELLVQETLDKKSYSRTGQLGFIHHLKKK
DQNMEKVPVLYTLDFIWNTLELNGLNHSVKDIEETIELVHPNICTDGCILFQASGSVVIL
LEVHSQQKFASLIPIIVATALAAHEIILDCVAFVPKGTFLRRPTGEKRRADILKQWTGGD
LKHMTSYLIRQDFLLNEDFVGTELIGTTDSYDYSDENLIINSSQLNLL
NT seq 4287 nt   +upstreamnt  +downstreamnt
atgaaaccttcagaaaacgaaaaaatccatcccgtaaggcattcgaaatatgaagataaa
agcaagttgccttttgagacaataccagacccagtgttaaaatatgtgaaaagagcaagg
gatgcagagctgcaaccacaattggccaaagtatctcagaagctgtttgcagatatatca
actgccacagcagctgaaaaactacaattcacagttccacgtagagccagatttgaaatt
aatgatccacgaaatccaacattttcaatgatggcgctgcaggatattatatctgtcctt
gagtatcgaagaaataaaaatccaacttctactgctcatatttgtatcgataaaaaaggg
aaagaagctgtgagttacagttgggataaaatcctgaatagagctaaacaatttgcgtct
gttgcgcaaaatcacgttggacttaaacctggaaccagagtaattttatattatcgaaaa
tcggaagcttcagaatatattattagtatctttggctgtttgttgcttggaatagtagta
attcctttgagtccttcctcatcttcagaaagtctcaagttggttgtcaatgaagaaaaa
gttcgtgtcgcatttactacagaggctacttatcgtatcttcataaaagatacagaggtg
aataatgcaaaaagccttgcatggtggaaatcaaacgactttacaaactacaaatttgaa
caaatcaaacagtatcggatgcgtgcgaatgacacagttctcattgattacacgttcagc
tcctcgacctataatgatattaaggctgtttataccacgaaaacatttttaagtcagatg
agaaatctgacatcgtccatgataaccaatccagctcgtcaagctggatggaagctccat
aattttgaggattcgaaagatgttctcattaccaatttccatccatctatgccattagga
ttgatcatgggggtattcaactctgtgtttgcaggatattgtaccatcttttgtgatgaa
gaagtactaaaaacgccaggtttattagcatatttaattactaaatatcgatgtacatac
agtttgtttgattatgctggactgaagcagacagtgtacaattatcaggaggatcctaaa
tctacactttcatttaaaaaaaattatacaccgaacctttcgtccttgaagttgtgtatg
gttgaatgcgaagtagtagacccggaattcaacattatagtctcagataggtggttgcaa
cctttaggtaccaataattccaaagaggtaatcactccgatattatgtttgcgaaagttt
ggtggaatacctatttcattcaaagactggatgatcagttacaccaacagacagaaacat
gaacggcaaatggccgatacttgttatcaagagatcttggtattaaagagttcaatagaa
aaggaaaaagtggaaattgttccatttctagatatccgaaaatattctcctaacgaagtc
ctttgcatgtctcccttttggtatccaatccctgaggcatcagtggcagttgttaatgaa
gattcgaagaatatatgcaaagttggtgaagttggagaaatttgggtttattctgattgt
cttcctaagttgaaagctgctagcgtgattaacaacccacaaggggaacaattaactgat
tacgaaaacaaccaagaaaataaatttgaaaagaataactcattcatggatagtggtcta
aaaggatttttgcataacgaaaagatttttgttcttggaaacaaagatgaacaaatcagg
caatatcggaaaacaatggtcgctgataagttaatggaagaaaaatatgtacactattct
cattacttgattaaaaaaatcatgaaatatgttcccgaaatttttgatggtgtcgccttt
gaaatagaaatcgacaaagcagtttactccgttttagtacttgaaagtccaattattaag
cgttcgttaattcgaaataatcggcttaaaggaagagatttgttctcagagttggtaaaa
ataacagagagcagcttccaagtcactcaagacatattcaaattagatgtcctaagcata
cttattgctccttacaaatcattacctcgatccaggtatatgggaatccaagcaatcaac
acgaataagtgtaaactggcctttttgtcaggaaatcttcctgtatcctatgttaggttt
ttcatggattcagcattaccaaaatctaaaattaatttaaacaattcaaaaggaatttgg
tcaaaagatgcctccaaacatcatagagagattatctctttaaatgttaaacaaaagatg
gatccgtacaagcatcaaaacaaagttagtaaagcacgagaaaatctgcttaatcacttt
actatccttgactttttaaaaaccaaatctgcaaagacaccaacttcacctgccatatta
acctttaatgctatcgaaaaaacaaaagtagagttgacttgggcccattttgagctgaaa
gttgcatctcatgttgaatatatgcagttatcagttaaagctaaagcaagatcacatatt
ttacttctttattacgacccattagagtttttgatcagcatacatagctgctttcaccta
ggggtgataccaataccgtttcaaattcgtgaaatatcacaattgattggggaaatagaa
gaattcacaaaaattgcaaaggccttcaatgtggaagcaatccttgttgatcataaagtt
cttatatctttaaaatccagggatatttcaaatcactttcaacaaacttgcattgacctc
aacatgaaggcacccaaaatatttgaaactactggaatccccatttcaaaacgtgcaaaa
aaagcattgaatctaataaccccgggggaattgaataataaagggaaagtcgcgctaatt
agtattaataagctggaagatggttccatcatcccaacgcaattttctcattctagtctt
ctggcattttgccatgaacaaaaagaatttgtaattggaaatgaagaaaaaccaatcatt
ggtgggattgaattctcaagtggaatgggcctattgcatactgccttgcttggagtatat
gcaggagtaccaactttattgataaaacaagaaaacttatgtaacaatggtagcctgctt
tttgaggctatcgagcaaaactctttatcaaaggttatgattccacttaacatttgtcag
aaaagcttttcaacagctcaaggttgtaatagcattgttattaactccactttgtcaagc
attattgtgccttgctacgacagaccaataagttctagagttaatagtataattgaagat
atcgccagaattggactagctcccaacaaggtaaaattggcatactctcatccgatcaat
cctttcgtttgttggaatgcggattcgagcatggaaaaaatgaaggattactttgatgcc
aatcagctaagaagcggtctcgtaaacgtaagagaggatgtcctaagaaacagacaacca
ctcctttatgggtccggaactagcacattatacaatgaaatatgcatagttcaccctgaa
gaaaaatacatatgtcaagaaggagaaattggagaaatttggattaacggaaagcacggc
tcatattgtgaaaacaacgaactcaactctggatgcgagcttctagtgcaagagacatta
gataaaaagagctattcgagaacagggcagttaggtttcattcatcatttgaagaaaaaa
gaccagaatatggaaaaagttccagttttatatactttagatttcatatggaatacgctc
gaattaaacgggcttaaccattccgtaaaggatattgaagaaacaatcgaattagtgcat
cccaacatttgcacagatgggtgcatattatttcaagcgtcaggatccgtagtaattctt
ctggaagtacatagtcagcaaaaattcgctagcctaataccaattattgttgctacggct
ttggcagcacatgaaatcatacttgattgtgttgccttcgtaccgaaaggaacatttttg
cgtcgtccaactggtgagaaaaggagagcagacatcctaaaacaatggactggaggagac
ctgaaacacatgacaagctatttaattcgacaggactttcttctcaacgaagattttgta
ggtactgagttgattggaacaaccgattcttacgattactcggatgaaaacttaataatc
aatagttcccaacttaatctcctttag

DBGET integrated database retrieval system