KEGG   Schizosaccharomyces pombe (fission yeast): SPAC22F8.04
Entry
SPAC22F8.04       CDS       T00076                                 
Name
(RefSeq) putative triose phosphate transporter
  KO
K15279  solute carrier family 35 (GDP-fucose transporter), member C1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC22F8.04
Transporters [BR:spo02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   SPAC22F8.04
SSDB
Motif
Pfam: TPT EamA
Other DBs
NCBI-GeneID: 2541895
NCBI-ProteinID: NP_594727
PomBase: SPAC22F8.04
UniProt: Q9UUI8
Position
I:4789789..4790940
AA seq 383 aa
MSSKLTVNAHYSPLKDEDPLDHIDSQTALDSMETDSTGKSSLYFSKSDDPLSKDIEDGIS
TRKLEEMSVLEANAKEPDSENAPVSRLTIFFAVSSQIVFAILVTILNKQALNIINAPLLM
LSFQMAFTSLMVKMYWRFSSVHFQTLRLASAIQLKKFIFVKILGIVSKTYCLAFVPVSFY
QISRGLLLPFTILLSFVLLKQKTRLFPFGGCLLVMLGFGFGVRFESHVAPIGIILGVWSS
FTTAIESVAVKHYVHEYPTLDLIYIFSALMSVFCLLLSVASLELLHTVQEVVGMQAIKFF
IVLILSSLSNFYLNIATFTQIKVTSPVTYMISVSARSILQTLLAVAFLGETLYGNRIYGV
ILILVGTLLYTLAKEHERRVASA
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgagttccaagctaaccgtcaatgcgcattactctcctttaaaggatgaagatccttta
gaccacattgatagccaaacggcgttggactctatggaaaccgactccactggcaaatct
tccttgtatttttccaagtcggatgatcccttgtcgaaagatattgaggatggtatatca
accaggaagttggaggagatgagtgttctcgaggccaatgcaaaagagcccgactcggaa
aatgctcctgtttcacgactgaccatattttttgcggtttcctcccaaatcgttttcgct
atcctagttaccattctcaacaagcaagctctcaatatcatcaacgcaccacttctgatg
ttgtcgtttcaaatggcattcacatctctcatggtaaagatgtattggcgattctcctcc
gttcattttcaaaccctaagattagcttctgcaattcaacttaaaaagtttatctttgtc
aagattcttggcatcgttagtaagacctattgcttggcttttgtacctgtctcattttac
caaatttccagaggtttgttgctaccctttacaattctcctttcatttgtattgttgaag
caaaaaactcgcttatttccctttggcggttgtttacttgtaatgcttggctttggcttt
ggtgtacgttttgagagccatgttgcccccataggaattatactgggtgtttggagttcc
ttcactaccgccatcgaatccgttgccgtcaagcattacgttcacgagtacccgacctta
gatttgatctacatcttttcagctttaatgtcggtgttttgtttgttgctatccgtggcg
tccctagaacttctccacacagtccaggaggttgtcggtatgcaggctatcaaatttttt
atcgtacttattctttcgtcactttctaacttttatttaaacattgctacttttacacaa
ataaaagtgacttctcccgtcacctacatgatttctgtatctgctcgcagtattctgcag
actttactagcagttgccttcttgggcgaaacactgtatggaaatcgcatttatggagta
attttaattttggtaggtacgcttctctacacacttgccaaagaacatgagcgccgtgtc
gcttctgcatag

DBGET integrated database retrieval system