KEGG   Schizosaccharomyces pombe (fission yeast): SPAC22F8.11Help
Entry
SPAC22F8.11       CDS       T00076                                 

Gene name
plc1
Definition
(RefSeq) phosphoinositide phospholipase C Plc1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00562  Inositol phosphate metabolism
spo01100  Metabolic pathways
spo04070  Phosphatidylinositol signaling system
spo04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SPAC22F8.11 (plc1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    SPAC22F8.11 (plc1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    SPAC22F8.11 (plc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC22F8.11 (plc1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     SPAC22F8.11 (plc1)
Membrane trafficking [BR:spo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    SPAC22F8.11 (plc1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    SPAC22F8.11 (plc1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_7 C2 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_like EF-hand_10 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 2541439
NCBI-ProteinID: NP_594734
PomBase: SPAC22F8.11
UniProt: P40977
Position
I:4807786..4810485
Genome map
AA seq 899 aa AA seqDB search
MNCEMVTSPESVNLGDSNRAVSPFCLPDCSENAVAQTRSKTLDNAALDLPYVGNRKKSEQ
DFFKMLSSRDRDAHSTLRKRSNSLSSFLSTKSTSASENKFHGGLNWLSLKLNLLLRLQGR
MNSARTNTSMNPYSCDSNENLSTLSSVNQNFNSRQLLATIVPESIQNGCSLLRITKKKVR
QRKVSLDPISGYLMLDKNTGKAYKKLCVDDIKEIRQGRDARNYREQYKISSENEKRWFTI
IYCADNKLKAMHMISPTLDAHNQWIMALEGLKTYRLNEFIIGLNLVCHQGEKMIDYSENL
NPWEKLEKEQSAQLDLGDVHRMCQMLHLNASMEFLEETFQKADADHSGKLSFEEFQHFVS
LLKTRSEIVDIFKEYTSGSDKMSLEQFRHFLSTSQKARLDSDSIRTLYVSFCSNDDSKMG
LIEFTSFLLSPHNSPVVPVIQDMSRPLNEYLISSSHNTYLLGKQFGGESSIEGYIRSLQR
GCKCIEIDCWDGPNGPVVCHGHTFTSMIKFNDVIDAIRKYAFVVSPYPLFISLEIHCCPD
QQRQMVSYMKQAFGDTLVMKPVTANESVLPSPEDLLNKILLKVKCSATPLHQFSTDILKV
GITDSSTDTTESSELENSELTGLRKGKRRMKNIIVQELQQLAPYARSLKFRNFSLPESKT
YSHIFSFSERTIKKHGKAMVPRLSKHNLRYLCRVYPGPLRVGSTNFNPQVYWRLGVQMVA
LNWQTYDTGLQINDALFIADPPTGYLLKPPCQRIIGTTVGEEGLPRKIKLTIDVISGQQL
RRARELSNSETLSPYVEIQVHSMEESPFRWCSKVVHENGFRPFWGETMVYESIISDDFYS
MIRFLVHHRGSNGNDSIFANFTCPIDRLQQGYRHIRLLDMQGENLLFSSLFLKIKKEDI
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtgaaatggtaacgtcgcctgaatcggtcaacttaggagactccaacagagca
gtaagtccattttgcctgcccgattgctcagaaaacgcagttgctcagacgaggagtaaa
accttagataatgctgctttggatctcccatatgttggcaataggaagaaatcggagcag
gatttctttaagatgctatcatcaagggatcgcgatgctcatagtactctacgtaaacga
tcaaattctttatcttcttttctgagtacgaaatcgacatcagcttcagaaaataaattc
catggaggattgaattggctttctctgaagttaaatcttttgctacgcttgcaaggtcga
atgaattctgcgagaacaaatacttcaatgaacccttactcatgcgatagtaacgaaaac
ttatctactctgagctcggtgaatcaaaactttaattctcgacagctattagctactata
gtccctgaatctattcaaaacggatgctctttacttcgtataaccaagaaaaaggtgcgc
caacgtaaagtctctttagaccctatatctggatatcttatgctggacaagaatactggt
aaagcttataagaagctttgtgttgatgacattaaagaaattcgacagggccgcgatgct
cgtaattatagagaacagtacaaaatttcttctgagaacgagaaacgctggttcacaatt
atatattgtgctgataataaattaaaggctatgcatatgatatctccaactttagatgcg
cataatcaatggattatggctttagaaggtctaaaaacttatcgattgaatgaatttatt
attggacttaatctcgtttgccatcaaggtgaaaaaatgatagattattcagagaattta
aatccctgggaaaagttagaaaaggagcaaagtgcacagttggatctaggagacgtgcat
cgcatgtgccaaatgctacatttgaatgcatcaatggagtttttagaagaaacatttcaa
aaggcagatgctgatcattctggaaagctaagttttgaagaatttcagcattttgtaagc
cttttaaaaacaagatccgagattgtagatatttttaaagaatatacatctggctctgac
aagatgtctttggaacagtttcgtcactttctatcaacttctcaaaaggctcgtttggat
agtgactcaattaggactttgtatgtctctttttgctcaaatgatgattcaaaaatgggt
ttgatagaatttacttcctttctactttctcctcataattctccagtagttcctgtgata
caagatatgtcgcgaccactgaatgaatacttaatttcttcgtcgcataacacttattta
ctaggtaagcagtttggtggagaaagttcaattgaaggttatatccgttcgctacagcgt
ggctgcaagtgtattgaaatcgattgctgggatggaccgaatggtcctgtagtttgtcat
ggacatacatttacttctatgataaaatttaatgatgttattgatgctatacgaaaatat
gctttcgtcgtttcaccttatccattattcatttctttggaaattcattgctgccctgac
caacaacgtcaaatggttagttacatgaaacaagcatttggggatactttggtgatgaaa
cccgttaccgctaacgaatcagttcttccttcacccgaagatttactgaacaaaattttg
ctgaaagtcaaatgttcagcaacaccattgcaccaattttcgacagacatactgaaggtt
gggataactgattcttcgactgatactaccgaatcatcggagctagaaaattcagaatta
acagggttaaggaaaggtaaaagacggatgaaaaatatcattgtgcaggaattgcaacag
cttgcaccttatgcccgatcattgaaatttcgaaatttttctttaccggaatcaaaaacg
tatagccacatattctcattttcggaaaggactataaaaaagcatggaaaagctatggtt
ccaagacttagcaaacataatttacgctatttgtgtcgtgtataccctggcccattgaga
gtaggaagtacaaattttaatcctcaggtgtattggcgcctgggtgtgcaaatggttgct
ctaaactggcaaacttatgatacaggtcttcaaataaatgatgctttgtttatagctgat
cctccgactgggtacttgttaaagccaccttgtcaacgaataattggtacaacagttggc
gaagaaggacttcctcgtaaaataaaattaacaatagatgtcatatctgggcaacaactt
agaagagctagagaactttctaattctgaaactctcagcccttatgttgagatccaagtt
cattcaatggaagaatctccttttcgttggtgttccaaagttgtgcacgaaaatggattt
cgacctttttggggagaaaccatggtttatgagagtataattagtgatgacttttattcc
atgatccgatttctcgtccatcatcgaggaagtaatggaaatgactctatatttgctaat
tttacttgtccgattgacagactgcaacaaggctatagacatattcgtttattggatatg
caaggcgaaaatttgttattttcgagtttgtttttgaaaattaaaaaagaagacatttag

DBGET integrated database retrieval system