KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23A1.10
Entry
SPAC23A1.10       CDS       T00076                                 

Gene name
tef102
Definition
(RefSeq) translation elongation factor EF-1 alpha Ef1a-b
  KO
K03231  elongation factor 1-alpha
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03013  RNA transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    SPAC23A1.10 (tef102)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPAC23A1.10 (tef102)
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPAC23A1.10 (tef102)
   03012 Translation factors [BR:spo03012]
    SPAC23A1.10 (tef102)
   04131 Membrane trafficking [BR:spo04131]
    SPAC23A1.10 (tef102)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC23A1.10 (tef102)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     SPAC23A1.10 (tef102)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    SPAC23A1.10 (tef102)
Translation factors [BR:spo03012]
 Eukaryotic type
  Elongation factors
   SPAC23A1.10 (tef102)
Membrane trafficking [BR:spo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    SPAC23A1.10 (tef102)
Exosome [BR:spo04147]
 Exosomal proteins
  Proteins found in most exosomes
   SPAC23A1.10 (tef102)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4
Other DBs
NCBI-GeneID: 2541984
NCBI-ProteinID: NP_594440
PomBase: SPAC23A1.10 SPBC839.15c
UniProt: P0CT54 P0CT55
Position
I:4095202..4096584
AA seq 460 aa
MGKEKGHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEATELGKGSFKYAWVL
DKLKAERERGITIDIALWKFETPKYNVTVIDAPGHRDFIKNMITGTSQADCAILIIGGGT
GEFEAGISKDGQTREHALLAYTLGVKQLIVAVNKMDTTGWSQARFEEIVKETSNFIKKVG
FNPKTVPFVPVSGFQGDNMIEPTTNMPWYQGWQKETKAGVVKGKTLLEAIDSIEPPARPT
DKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMIVTFAPAGVTTEVKSVEMHHESLDAG
LPGDNVGFNVKNVSVKDIRRGNVCGDSKNDPPMGCASFTAQVIILNHPGQISAGYSPVLD
CHTAHIACKFAELIEKIDRRSGKKIEESPKFVKSGDACIAKMVPSKPMCVEAFTDYAPLG
RFAVRDMRQTVAVGVIKAVEKVAPGAAKVTKAAVKAGAKK
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgggcaaagaaaagggacatattaacgtcgttgttatcggtcacgtcgattctggtaag
tctaccaccactggtcacttgatttacaagtgcggtggtattgacaagcgtaccattgaa
aaattcgagaaggaagctaccgagttgggtaagggttccttcaagtacgcctgggttttg
gacaagctcaaggccgagcgtgaacgtggtatcaccatcgacattgccctttggaagttc
gagactcccaagtacaatgttactgtcattgatgcccccggtcaccgtgatttcatcaag
aacatgattaccggtacttctcaagctgactgtgctatccttattattggtggtggtact
ggtgaattcgaggctggtatctccaaggatggtcaaacccgtgagcacgctttgcttgct
tacaccttgggtgtcaagcaacttattgttgccgtcaacaagatggacaccactggctgg
tcccaagctcgtttcgaggaaatcgttaaggagacctccaacttcatcaagaaggtcggt
ttcaaccccaagaccgttcctttcgtccctgtctccggtttccaaggtgataacatgatt
gagcccaccaccaacatgccctggtaccaaggctggcaaaaggagaccaaggctggtgtc
gtcaagggtaagactcttttggaggctattgactccattgagccccctgcacgtcccact
gacaagcctcttcgtcttccccttcaagatgtttacaagatcggtggtattggtacagtt
cccgtcggtcgtgtcgagactggtgttatcaagcccggtatgattgtcaccttcgctccc
gctggtgtcactaccgaagtcaagtctgttgagatgcaccacgagtctctcgacgctggt
cttcccggtgacaacgttggtttcaacgtcaagaacgtttccgtcaaggatattcgccgt
ggtaacgtctgtggtgactccaagaacgatcctcccatgggttgtgctagcttcaccgct
caagtcatcattcttaaccaccccggtcaaatctctgctggttactctcctgttttggat
tgccacactgctcacattgcttgcaagttcgctgagctcattgagaagattgaccgtcgt
tccggtaagaagattgaggagtcccccaagtttgtcaagtctggtgatgcttgcattgct
aagatggttccttccaagcccatgtgtgttgaagctttcactgactacgctcctcttggt
cgtttcgctgtccgtgacatgcgtcaaaccgtcgctgtcggtgtcatcaaggctgtcgag
aaggttgctcctggtgccgccaaggtcaccaaggccgctgttaaggctggtgccaagaag
taa

DBGET integrated database retrieval system