KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23A1.12c
Entry
SPAC23A1.12c      CDS       T00076                                 

Gene name
frs1
Definition
(RefSeq) putative phenylalanine--tRNA (Phe) ligase beta subunit Frs1
  KO
K01890  phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPAC23A1.12c (frs1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPAC23A1.12c (frs1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPAC23A1.12c (frs1)
Enzymes [BR:spo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.20  phenylalanine---tRNA ligase
     SPAC23A1.12c (frs1)
Amino acid related enzymes [BR:spo01007]
 Aminoacyl-tRNA synthetase
  Class II (U)
   SPAC23A1.12c (frs1)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SPAC23A1.12c (frs1)
 Prokaryotic type
    SPAC23A1.12c (frs1)
SSDB
Motif
Pfam: tRNA_synthFbeta PhetRS_B1 B3_4 B5
Other DBs
NCBI-GeneID: 2541974
NCBI-ProteinID: NP_594442
PomBase: SPAC23A1.12c
UniProt: O42849
Position
I:complement(join(4098303..4100014,4100066..4100123))
AA seq 589 aa
MPTISCDKEELYKALGREYTTQEFDELCFQFGIELDEDTTNDPERSPSERPSLKIDIPAN
RYDMLCLEGIAQALNVFNRRMATPQYKLLPSTTSLTISPETSEIRPYAAAAILRGVKLDP
IRYQSFIALQDKLHANLCRNRTLVAIGTHDFSVMEGPFTYEALKPEEINFVPLNQTQEIN
GSNLLEFYKDSKHLSRYLHIIANSPRYPVILDAKRRVCSLPPIINSEFSKISVDTRDIFI
DVTATDKTKLEIVVNMMTTMFSCYCEEPFTIEPVNIISEHNGCTRVTPNLNPTCFKADID
YLNEACGLSLPEDEICHLLTRMMLTAKPNPNDSKTLLVYVPPLRADILHQCDIMEDLGIA
YGYDNLKHTYPAHSVTFGKPFEVNRLADIIRNEVAYAGWSEVMPFILCSHDENYAWLRKT
DDSKAVQLANPKTLEFQVVRSSLLPGILKTVRENKNHALPIKIFEVSDVAFCDYSRERMT
RNERHLCAIFAGLNSGFEQIHGLLDRVMLMLNTKRIMNPKDSDAVGYWIEAEDDSTFFPG
RCAAVYYRKDFGTAGIRVGVFGVLHPLVLEKFELTSAASAVEIDLTLWV
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgcctaccatcagctgtgacaaggaagagctgtacaaggccctaggaagagagtacaca
actcaagagtttgatgaactctgcttccaatttggaattgagcttgatgaagacactaca
aatgacccagaaagaagtccttctgagcgtccttctttaaaaattgacattccggcaaat
cgctacgatatgctctgcttagaaggaatcgcccaggctttgaatgtgtttaatcgtcgc
atggctactcctcaatacaaattacttccttccaccacttcactcacaatttcccctgaa
acctcggaaattcgtccttatgccgctgcagctatcttacgaggtgtgaagcttgatccc
attcgttaccagagcttcattgccttacaagacaagttacatgcaaatttgtgtagaaac
cgtacccttgtagccattggtacccatgacttctctgtaatggaaggtccgtttacctac
gaggcattaaaacccgaagagatcaatttcgttcctttgaatcaaacccaggaaatcaat
ggttctaatttattagaattttacaaggatagtaaacatctttcccgttatttacacatc
attgccaactctcccagatatcctgtaattttggatgctaagagaagggtttgctcactt
ccccctatcattaatagtgagttcagtaagatcagtgtggatacccgggacatcttcatc
gatgttaccgcaaccgataaaactaaactcgaaattgttgtcaacatgatgaccacgatg
ttctcttgttactgtgaagagccttttaccattgagcctgttaatatcatatctgagcac
aatgggtgtactcgtgttactcctaatttgaatcctacatgttttaaagctgatatcgac
tatttgaacgaagcctgtggattgtcccttcccgaagatgagatctgtcatttgttgacc
cgaatgatgcttacagcaaagcccaacccaaatgattccaagactcttttggtatacgtt
ccacccttgcgcgctgatattcttcaccagtgtgatattatggaggatcttggcattgct
tatggatatgacaatttgaaacacacttatcctgctcatagtgttacatttggcaagcct
tttgaggttaatcgactagctgacattattcgtaatgaagttgcatatgctgggtggtcc
gaggtcatgcctttcatcctttgctcccatgacgagaattatgcatggcttcgaaagact
gatgattcaaaagctgttcaacttgcaaatcccaagactttagaatttcaagttgttcgt
tcaagcttgcttcctggtattttgaaaacggttcgcgagaacaaaaatcatgctttaccg
attaaaatatttgaagtcagcgacgtagccttttgtgattattccagagagcgcatgact
cgtaatgagcgtcatctttgcgccatttttgcaggtttgaactctggttttgaacaaatt
catggcttgttagatcgtgtgatgcttatgttaaatactaaacgcatcatgaatcccaaa
gattccgatgctgtgggatactggatcgaggctgaggacgacagcacctttttcccaggt
cgatgtgcagcagtgtactatcgtaaagattttggtactgctggaattcgcgttggtgta
tttggtgttctccatccccttgttttagagaagtttgaactcacttctgctgcttccgct
gttgaaattgatttgacactttgggtttag

DBGET integrated database retrieval system