KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23C11.08
Entry
SPAC23C11.08      CDS       T00076                                 
Symbol
php3
Name
(RefSeq) CCAAT-binding factor complex subunit Php3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C TFIID-18kDa PAN_3 Bromo_TP CENP-S TFIID_20kDa
Other DBs
NCBI-GeneID: 2542027
NCBI-ProteinID: NP_593639
PomBase: SPAC23C11.08
Ensembl: SPAC23C11.08
UniProt: P36611
Position
I:<2145681..>2146388
AA seq 116 aa
MSADGLDYTNLLPIANVARIMKSALPENAKISKEAKDCVQDCVSEFISFVTGEASEQCTQ
EKRKTITGEDVLLALNTLGFENYAEVLKISLTKYREQQARSASMKETKQSRSEEPQ
NT seq 351 nt   +upstreamnt  +downstreamnt
atgagcgcagacgggttggattacaccaatctcctaccaattgcaaatgtcgcgcgtatc
atgaaatcggcacttcccgaaaacgccaagatttccaaggaagctaaagactgcgtccaa
gattgcgttagtgagtttatttcctttgttactggtgaagcatctgaacaatgcactcaa
gaaaagagaaagacaattactggtgaagatgttttattggctttaaatacccttgggttc
gaaaattatgccgaagttttaaagatttctctcaccaaatacagagagcaacaagcaaga
tctgctagcatgaaagaaactaaacaaagccggtccgaagagcctcagtaa

DBGET integrated database retrieval system