KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23C11.10
Entry
SPAC23C11.10      CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: HVSL
Other DBs
NCBI-GeneID: 2542061
NCBI-ProteinID: NP_593641
PomBase: SPAC23C11.10
UniProt: O13915
Position
I:join(2150624..2150744,2150784..2150882,2150930..2151128,2151180..2151342,2151386..2151601)
AA seq 265 aa
MSLVCYESSSSGEDDDETISDNPRMLKVPKLQESFHELYKKKPKTFDSPEFHEGRIRGQK
HIEGLWFVQTYLEVDLSKKVKKGIREFLNSQSRFQSLLCSEHNVPRRLHLSISENYRINY
STKNQLVHKWEQYTNNLNYRTLKFRLGKMCLLFNDEKTRMFLAFECKFSDENYKDLISHA
SDCMKEFTNRNLREDFLLHISFASSLTNEDEYQNWVSQDRESHFFKTMNEIINTKIQKDQ
FSESFIVDSLKLSIGHLIFTFPFCK
NT seq 798 nt   +upstreamnt  +downstreamnt
atgtctttagtatgttatgagagttcgagctccggagaagacgatgacgagacaatatct
gataatccccgaatgttaaaagtccctaagctccaagaatcatttcacgaactttataag
aaaaagccaaaaacttttgatagtcctgagtttcatgagggtcgaattcgtggacaaaag
catattgaaggattgtggtttgttcaaacatatttggaggtggatttgagcaagaaagtt
aaaaaaggcattcgtgagtttttgaattcacaaagtcggtttcaatcgcttctttgctct
gagcataatgtaccaagaagattacatttaagcatatctgaaaactaccgcataaattat
tccactaagaaccaattagtgcacaaatgggaacaatatacaaacaatttgaattacaga
actttaaaatttcgactgggaaagatgtgtctactatttaatgacgaaaaaacaagaatg
ttcctagctttcgaatgtaaattcagtgacgaaaactacaaagacttaataagtcatgct
agtgactgtatgaaagagtttacaaataggaatttgagagaggactttttacttcacata
tcctttgcttcatcgttgacaaatgaagacgaatatcaaaattgggtcagtcaagacaga
gagtcccatttttttaaaacgatgaatgaaattattaatacaaagattcaaaaagatcaa
ttttctgaaagttttatcgttgatagcttaaagttgtcaattggacatctaatatttacc
tttccattttgtaaataa

DBGET integrated database retrieval system