KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23C11.12
Entry
SPAC23C11.12      CDS       T00076                                 

Gene name
hcn1
Definition
(RefSeq) anaphase-promoting complex subunit Hcn1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: ANAPC_CDC26
Other DBs
NCBI-GeneID: 2542045
NCBI-ProteinID: NP_593643
PomBase: SPAC23C11.12
UniProt: O13916
Structure
PDB: 
2XPI

Position
I:2154795..2155037
AA seq 80 aa
MLRRNPTAIQITAEDVLAYDEEKLRQTLDSESTTEEALQKNEESTRLSPEKKKIIRERRI
GITQIFDSSMHPSQGGAAQS
NT seq 243 nt   +upstreamnt  +downstreamnt
atgttacgaagaaatcctacggcaatacaaattactgctgaagatgttcttgcatatgac
gaagaaaagctaagacaaacgcttgattccgagtcaacaacagaagaagcattgcagaaa
aacgaagagtcaacacgtttatcgcctgaaaagaagaaaattattcgtgaaagaaggatt
ggaattactcaaatatttgattcttcaatgcatccttcccaaggtggagccgctcaatca
tag

DBGET integrated database retrieval system