KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23C11.13c
Entry
SPAC23C11.13c     CDS       T00076                                 

Gene name
hpt1
Definition
(RefSeq) putative xanthine phosphoribosyltransferase
  KO
K07101  uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPAC23C11.13c (hpt1)
SSDB
Motif
Pfam: Pribosyltran AMP_N Fe-ADH MGDG_synth
Other DBs
NCBI-GeneID: 2541970
NCBI-ProteinID: NP_593644
PomBase: SPAC23C11.13c
UniProt: O13917
Position
I:complement(join(2155562..2156048,2156323..2156456))
AA seq 206 aa
MDPVRLYYSYNDIHKMCAQQAEKILETFRPDVIIAIGGGGFIPARILRTFLKKKGSKNIP
IQAIGLSLYEELVSDSPEEVPGLEVKRTQWLDFSTLGMVDLVGKNILIVDEVDDTRTTLH
YALRELQRDVAEQAKKLNREGEKTTFGIFVVHNKVKPKNAQLDKEILDKYYFTGCNTPDC
WIMYPWEAQDIEEHDSHVAKMGDLKP
NT seq 621 nt   +upstreamnt  +downstreamnt
atggatcccgttcgtctttattacagctacaatgacattcataagatgtgtgctcaacag
gcagaaaaaattttggaaacctttcgtcctgatgtgattatagccattggaggtggtgga
ttcattccggctagaatccttcgtactttccttaagaaaaaaggaagcaaaaatattccc
attcaagccattggtctcagcctgtatgaagagcttgtttctgattcccctgaagaagtt
cctgggcttgaagttaagcgaactcaatggcttgattttagtactcttggaatggttgat
ctcgttggcaagaacattctaattgttgacgaggtagatgatactcgtaccactctccat
tatgctcttcgcgagcttcaaagagatgttgccgagcaagctaagaagcttaaccgtgaa
ggagagaagaccacatttggtatttttgttgtccataataaggttaaaccaaaaaatgct
caattggataaggagattttggataaatattactttactggttgcaatactcccgactgc
tggatcatgtatccttgggaagctcaagacattgaggagcatgacagtcatgttgcaaaa
atgggggatttgaagccatag

DBGET integrated database retrieval system