KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23C4.03
Entry
SPAC23C4.03       CDS       T00076                                 

Gene name
hrk1
Definition
(RefSeq) haspin-like kinase Hrk1
  KO
K16315  serine/threonine-protein kinase haspin [EC:2.7.11.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPAC23C4.03 (hrk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC23C4.03 (hrk1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPAC23C4.03 (hrk1)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: Other
  Haspin family
   SPAC23C4.03 (hrk1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    SPAC23C4.03 (hrk1)
SSDB
Motif
Pfam: Haspin_kinase Pkinase ABC1 Choline_kinase
Other DBs
NCBI-GeneID: 2541959
NCBI-ProteinID: NP_593176
PomBase: SPAC23C4.03
UniProt: O13924
Position
I:1034296..1035762
AA seq 488 aa
MESRSKVKTYGKNRRYINKDIEIWASLDERPCALKPRNIENFNNQERSDLEHIHSKPKKD
SLLSWNILLKKGSYKENELLAKRNQNLVPTVIIPASPRDNASKSVVSKKEVVNLSSSVAL
SGKPANNSKLDPLHRLLQIVAQEDALPFSQFVKSQTFEIQKIGEASYSEVYQASNADDVP
VVWKVIPFGEDGQAQYADVLNEVQISQWIKVDGFANLHQVVVVKGTYPSLLLEEWDRYLM
QNGSENDRPDSYSSTQLYCVLCLDHSGTDLEHFELRSWRECWSVFYETLKILSLVETRYE
FEHRDLHWGNILIRKADRSEEEVSFLLNEISLDDIESVDFPGSQDKADDFDNILQVTLID
FTLARASYSQGIISYNEFNDPDLFNGVDDYQFDIYRLMSRVTKGRWAQFFPITNVLWLHY
LIHQLLHKKNLSSPLTETETLMRSRLKQIFRLIDPVKTMQFQQAEDSIRSKSTVTSATSL
LNWVRQKY
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggaaagtcgttcaaaagttaaaacttatggaaagaaccgtagatatattaataaagat
attgaaatttgggcttctttagatgaacggccttgtgctttgaaacctcggaacattgaa
aattttaataaccaagaaagaagtgaccttgagcatattcactctaaaccgaaaaaagat
tcattattatcttggaacattctcttaaaaaaaggttcatacaaagaaaatgagttattg
gcgaaacgaaatcaaaacctggtacctactgtcataataccggcttctcctcgggataat
gcatcaaagtcggtagtcagtaaaaaagaggttgtaaatttgtcatcttctgttgcttta
tccggaaaacccgcaaataattccaaattagatccacttcatcggctcctccaaatagta
gcgcaagaagacgctcttccattcagtcaatttgttaagtctcagacttttgagatccaa
aaaattggcgaagcaagttatagtgaagtataccaagccagcaatgctgatgacgttccc
gttgtttggaaagttatcccgtttggagaagacggacaagctcaatatgctgatgtccta
aatgaagtacagattagccaatggataaaagtcgacggttttgcaaaccttcatcaagta
gttgtcgttaaaggtacttatccttcacttttattagaagaatgggatcggtatcttatg
caaaatggttctgagaacgatcgaccagatagctattcatcaacgcaactttattgtgtt
ttatgtcttgatcattcaggaacagatctggaacattttgagctccgtagttggcgagag
tgctggtcggttttttatgaaacattaaaaattctttctttagttgaaactcgttatgag
tttgagcatagagatttacattggggaaacattcttattcggaaagctgatcggagtgaa
gaggaagtttcgtttcttttaaatgaaatatcgcttgacgacattgaaagtgtcgatttt
cccggctcacaagataaggctgatgattttgacaacatacttcaagttacgctgattgat
tttacattagcccgagcatcgtattctcagggtataattagttacaatgaatttaacgac
cccgatctgtttaacggtgtagatgactaccaatttgatatatataggttaatgtctaga
gtgacaaaaggaagatgggcgcagttttttcccattacaaacgttttatggctgcattat
ttaattcatcaacttttacacaaaaagaacttgtcatcgccgttaacagagactgagacg
cttatgagaagtcgtcttaagcaaatatttaggcttattgaccctgttaaaacaatgcag
ttccagcaggccgaagactcgattcgctctaaatctacagttacatctgcaacttctctc
ctcaattgggtccgtcaaaaatactaa

DBGET integrated database retrieval system