KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23C4.12
Entry
SPAC23C4.12       CDS       T00076                                 

Gene name
hhp2
Definition
(RefSeq) serine/threonine protein kinase Hhp2
  KO
K14758  casein kinase I homolog HRR25 [EC:2.7.11.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    SPAC23C4.12 (hhp2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPAC23C4.12 (hhp2)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPAC23C4.12 (hhp2)
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPAC23C4.12 (hhp2)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPAC23C4.12 (hhp2)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   SPAC23C4.12 (hhp2)
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Pre-40S particles
   Kinases
    SPAC23C4.12 (hhp2)
  Pre-60S particles
    SPAC23C4.12 (hhp2)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  tRNA modification factors
   Elongator related proteins
    SPAC23C4.12 (hhp2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal ABC1 APH Pox_ser-thr_kin Choline_kinase Kinase-like Haspin_kinase
Other DBs
NCBI-GeneID: 2541929
NCBI-ProteinID: NP_593184
PomBase: SPAC23C4.12
UniProt: P40236
Position
I:join(1049035..1049198,1049365..1050088,1050175..1050489)
AA seq 400 aa
MTVVDIKIGNKYRIGRKIGSGSFGQIYLGLNTVNGEQVAVKLEPLKARHHQLEYEFRVYN
ILKGNIGIPTIRWFGVTNSYNAMVMDLLGPSLEDLFCYCGRKFTLKTVLLLADQLISRIE
YVHSKSFLHRDIKPDNFLMKKHSNVVTMIDFGLAKKYRDFKTHVHIPYRDNKNLTGTARY
ASINTHIGIEQSRRDDLESLGYVLLYFCRGSLPWQGLQADTKEQKYQRIRDTKIGTPLEV
LCKGLPEEFITYMCYTRQLSFTEKPNYAYLRKLFRDLLIRKGYQYDYVFDWMILKYQKRA
AAAAAASATAPPQVTSPMVSQTQPVNPITPNYSSIPLPAERNPKTPQSFSTNIVQCASPS
PLPLSFRSPVPNKDYEYIPSSLQPQYSAQLRRVLDEEPAP
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgacggttgttgacattaagattggtaataaatatcgtataggtagaaaaattggttct
ggctcctttggtcaaatttacctgggattaaatacggtaaatggagaacaagttgctgtg
aaattggagcctttaaaggctcgtcatcatcagttagaatatgagtttcgtgtgtataat
attcttaaaggaaatattggcatacccacaattcgctggttcggtgtaaccaatagttat
aatgctatggtcatggatttattaggcccttctctggaagatttattctgctattgtgga
agaaagtttactcttaaaacggttcttttacttgctgatcaactcatcagtcgcattgaa
tatgttcactccaagtcattcttacatcgagacattaagcctgataattttttaatgaag
aagcacagcaatgttgttacgatgattgacttcggattggcgaaaaaatacagggatttt
aaaactcatgttcatattccatatcgagataataagaatcttacgggaacggctcgatat
gctagtattaacacccatattggtattgaacaatctcgccgtgatgacctcgaatcgtta
ggttatgttttactttatttttgtcgcggcagtttgccctggcaaggcttacaagctgat
acaaaggagcaaaagtatcaacggatacgtgataccaagattggcactcctttggaagtc
ctttgcaaaggtcttcccgaagagtttatcacttacatgtgttacactcgtcagctttcg
tttaccgagaagccaaactatgcttatttgagaaagctgtttcgtgatttacttattcgt
aaaggataccagtatgactatgtttttgactggatgatattaaaataccaaaagcgagct
gctgctgctgccgccgcttctgctacagcacctccacaggttacatctcctatggtgtca
caaactcaaccggttaatcccattactcctaattattcatccattcccttacctgctgag
cggaatccaaagactccacaatctttctccactaatattgttcaatgtgcttctccctca
cctcttcctctctcctttcgttctcctgttcccaacaaagattatgaatacattccatct
tcgttgcaacctcaatacagtgctcaactgaggcgtgttttagatgaagaaccagctcct
tga

DBGET integrated database retrieval system