KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23D3.12Help
Entry
SPAC23D3.12       CDS       T00076                                 

Definition
(RefSeq) putative inorganic phosphate transporter
  KO
K08176  MFS transporter, PHS family, inorganic phosphate transporter
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPAC23D3.12
Transporters [BR:spo02000]
 Major facilitator superfamily (MFS)
  Phosphate and organophosphate transporters
   Phosphate:H+ symporter (PHS) family [TC:2.A.1.9]
    SPAC23D3.12
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 2541484
NCBI-ProteinID: NP_594549
PomBase: SPAC23D3.12
UniProt: Q09852
Position
I:4362901..4364580
Genome map
AA seq 559 aa AA seqDB search
MNRLNPFSKSHSKNSNENNEVSLADVAESDTRRHWLGLTKREFKLMGFAGAGFFLDSYDL
FIINLVSPIYEYLYWGGLEGKKPHYPSGIHGLVNAAANIGNVFGQILFGFMGDFFGRKFV
YGKEMIVVIIATVLVIALPKSIPTPLGKMMWIFAWRWLLGLGIGGDYPMSATITSERSLL
SRRGTLLSIVFSFQGFGTLAGAIVTIILLACFEKPLNQRGEYTKLEGVWRLQMGLALVPA
LLVLIPRLTMKESKSYEQSKALNKYTDNDTYIADDDEPKKDNQNVVEEKQINLTTSSDSH
PTSTEDFGDKRASTVPTSENTSGFIEYFSQWHHFKHLLATAVSWFLLDIAFYGVNLNQSV
ILKAIGFSSGKNEYHTLMRGAIGNLIIAIAGYVPGYWFTVFLVEKLGRKWIQLQGLFITG
LMFAILAGSWDTISTGGRFACFVIAQFFSNFGPNATTFLYPAEVFPARVRGTAHGLSAAL
GKCGAILASLLFNFLTSVIGYGNVMWIFCGCMWGAIFFTLLLPETKMRDADEIDREEVLR
GGNGKTHQGRWSWYFNGIF
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcttaaatcctttttcaaaatctcactccaaaaactccaatgaaaacaacgaa
gtttccttggctgatgtcgccgagtccgatactcgtcgccattggcttggtttgactaaa
cgagaattcaagctcatgggctttgctggtgccggtttcttcctcgattcttatgacttg
ttcatcattaatctcgtctcccccatttacgaatatttatactggggcggtttggagggc
aaaaagcctcactacccttccggtatccatggtcttgtcaacgctgccgctaacattgga
aatgtctttggtcaaatcttgtttggcttcatgggcgatttctttggtcgtaaatttgtc
tacggtaaagagatgatcgtcgttattattgctaccgtccttgtcatcgcccttcccaaa
agtatacctactcctcttggtaaaatgatgtggatctttgcttggcgttggttgctgggt
ttaggaattggtggtgactatcctatgtccgcaacaatcacatcagaacgctctttgctt
agtcgtcgtggtacccttctctccatcgtcttctcctttcaaggctttggtactctggcc
ggcgccatcgtcactatcatcctcttggcctgctttgagaagcctctcaaccaacgtggc
gagtacactaagcttgaaggtgtatggcgtcttcaaatgggtttggctttggttcctgcc
ctcctcgttttgattccacgtctcactatgaaggaatccaagtcctatgaacagtcgaaa
gctctcaacaagtataccgacaacgatacctacattgctgacgacgacgaaccgaagaaa
gataaccaaaacgttgttgaagaaaagcaaattaatttgaccacctcctcggactctcac
cctacttctacagaggattttggagataaacgtgcatccactgttccaacttctgagaat
accagtggatttatcgaatatttcagtcaatggcaccatttcaagcatctcttggctact
gccgtgtcctggttcctactcgatattgccttttacggtgttaatctcaatcaatccgtc
attttaaaggccattggctttagttcgggaaagaatgagtatcacacacttatgcgtggt
gctatcggtaatctcatcattgcaattgctggttatgttcctggttattggtttacagtt
ttcctcgttgagaaacttggccgtaaatggatccaacttcaaggattgtttattaccggt
ttaatgtttgccatccttgcaggtagttgggacaccatttctacgggtggaagatttgca
tgttttgtcattgcccaatttttctctaattttggacccaatgccactacttttttgtat
cctgctgaagtttttcctgcacgtgttcgtggtaccgctcatggtctttctgctgctttg
ggtaaatgcggtgccatcttggcttctctgttgtttaacttcttaacatctgtaattggc
tatggcaatgtcatgtggattttctgcggctgcatgtggggagcaatctttttcactttg
cttctccctgaaaccaagatgcgggatgccgatgaaattgatcgcgaagaagttttgcgc
ggtggtaatggtaaaactcaccagggccgctggtcttggtatttcaacggaattttctaa

DBGET integrated database retrieval system