KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23E2.01
Entry
SPAC23E2.01       CDS       T00076                                 

Gene name
fep1
Definition
(RefSeq) Fe-sensing transcription factor Fep1
  KO
K09184  GATA-binding protein, other eukaryote
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spo03000]
    SPAC23E2.01 (fep1)
Transcription factors [BR:spo03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    SPAC23E2.01 (fep1)
SSDB
Motif
Pfam: GATA Big_1 Prp19
Other DBs
NCBI-GeneID: 2541522
NCBI-ProteinID: NP_592936
PomBase: SPAC23E2.01
UniProt: Q10134
Position
I:443569..445263
AA seq 564 aa
MAAKPAPFGQSCSNCHKTTTSLWRRGPDNSLLCNACGLYQKHRKHARPVKSEDLKDISPL
IQQVCKNGTCAGDGFCNGTGGSASCTGCPALNNRIRSLNASKSQSGRKSLSPNPSSVPSS
TETKASPTPLESKPQIVSDTTTETSNGTSRRRSSHNQHEDSSPPHEPSVTFCQNCATTNT
PLWRRDESGNPICNACGLYYKIHGVHRPVTMKKAIIKRRKRLVFNGNANESQHNLKRMSS
GDSGSSVKQQSTRDGPFSKSFPNGNGHASGNSGEGLAEHGMNTGVLPPASTFPSYNSNFT
GFLPSSFNPSPLMTLSRLAAGEPDNNGKVYYSYGPTQEQSILPLPENKHEGLPPYQNEYV
PNGIRANQVVYPGQLVAVGNDSSKQLSESTTSNTDNNGVATANQSNPLGMKFHLPPILPV
GESVCLPPRTSAKPRIAEGIASLLNPEEPPSNSDKQPSMSNGPKSEVSPSQSQQAPLIQS
STSPVSLQFPPEVQGSNVDKRNYALNVLSQLRSQHDLMIQELHNLNQHIQQIDEWLRSSD
NENMASEHIKSSTPAVVASGALQT
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggctgcgaaacctgctccttttggccaaagttgttccaactgccacaaaactactact
tctttatggcgtcgtggccccgataattcccttttgtgcaatgcttgtggcttatatcaa
aaacatcgcaagcatgcccgtcctgtcaaatctgaagatttaaaagacatttctccactg
atacagcaagtttgtaaaaacggaacctgtgctggagatggattctgtaacggtacgggt
ggcagtgcttcatgtactggttgtcctgctttaaataatcgtataagaagtctcaatgct
tctaagtctcagagcggacgcaaaagtctatctcccaatcctagcagtgtaccctctagc
actgaaaccaaagcttcgcctacacctctagaatcgaaacctcaaatcgtttcagatacc
acgactgaaactagcaatggcactagtagacgacgttctagtcataaccagcatgaagac
tcatctcctcctcatgaaccaagtgttactttttgccaaaactgtgctaccacaaatact
cctttgtggcgccgcgacgagtcgggtaatccgatctgtaatgcttgtggtttgtattac
aaaattcatggggtacatcgtcccgttaccatgaagaaggcaatcattaaacgtcgaaaa
aggctggtttttaacggtaatgcgaatgagtcgcaacacaacttaaaaagaatgtcaagt
ggggattccggatcttccgttaagcaacagtctacaagggatggtcctttttctaaatct
tttcccaatggtaatggccatgcttctggaaattctggtgaaggtctggctgagcatgga
atgaatactggagtattacctccggctagtacatttccttcatacaacagcaattttacc
gggttcttgccttcttcgttcaatccttcaccattgatgacattgtcacggttagcggct
ggtgaacctgataataatgggaaagtttattactcatatggtcctactcaggaacaatca
atattgcctcttcctgagaacaagcatgaaggattgcctccttaccaaaatgagtatgtt
cccaatggtatacgagctaatcaagtagtataccctggtcagcttgtagcagttggcaat
gattctagtaagcaattatcggaatctacaacatcgaacacggataataatggcgttgca
actgccaaccaatccaaccccttaggcatgaagtttcatttacctcctatccttcctgtt
ggcgagtcagtctgtttgcctcctcgaacttctgcaaagccaaggattgctgaaggaatt
gcttccttacttaaccccgaagagccaccctcaaattccgacaagcagccatcaatgtca
aatggaccgaaatcagaagtttcaccttcgcaatctcagcaagctcctttaatccaatcc
tctacctcgccggtttctttgcagtttcctcctgaagttcagggatcaaatgtagataaa
cgcaattatgctttgaatgttctttcgcaattgcgttctcagcatgatttaatgattcag
gagttgcacaatttaaatcagcacattcaacaaatagatgaatggctgaggtcctctgac
aatgaaaatatggcttctgaacatattaaatcctcaacccctgctgttgttgcatctgga
gctcttcaaacataa

DBGET integrated database retrieval system