KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23G3.10cHelp
Entry
SPAC23G3.10c      CDS       T00076                                 

Gene name
ssr3
Definition
(RefSeq) SWI/SNF and RSC complex subunit Ssr3
  KO
K11650  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:spo03021]
    SPAC23G3.10c (ssr3)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC23G3.10c (ssr3)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     SPAC23G3.10c (ssr3)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    SPAC23G3.10c (ssr3)
   PBAF complex
    SPAC23G3.10c (ssr3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SWIB
Motif
Other DBs
NCBI-GeneID: 2541438
NCBI-ProteinID: NP_593110
PomBase: SPAC23G3.10c
UniProt: Q9P7S3
Position
I:complement(885895..887172)
Genome map
AA seq 425 aa AA seqDB search
MSNNSRLPENGVQSGNGEDAELKKSMRIIEREIPDSLLEKIPEAEDYIALQDLERKLDSL
IVRKRFDLQDSLSRNSHKTRILRMYIHSTVANQSWQQKGENQENNSGDINSLPIPEWTLH
IEGRLLVNPDDEDDKAFELAPFTNFFRKIAIQILRSDDLYPSGNYVEWNKLPDNSNTSNG
ITVTRKGDQSVDVKIMLYPEEHPERYKLSKAFANILGIREGTRPDIVSYLWQYIKFHRLQ
DMEEKRLINCDKALRDLFEADRLYFPRIPELMNRFLEPIDPIVIPYTINVSEHTVEKVTI
FDIRINTEDPRHSQIRSFLATMMSQDKIRSIDDKLTELIQAITYSQSKYDFMKKFSESPI
EFINEWIESQSRDLEIVLDGTNMNYAEKRSADYYQQPWVHESAFHYLNLLNSKKQQSVLN
ASAKK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtctaataatagccgtttaccagagaatggtgtacaaagcggtaacggagaagacgca
gagttgaagaagagtatgagaattattgaaagagaaattccagactcattgcttgaaaaa
atcccagaagcagaagattatattgctcttcaagatttagaaagaaaattggattcatta
atcgttcggaaacgatttgatttacaggattccttaagtcgaaactctcacaaaaccagg
attcttcgtatgtacatacattccactgttgcgaatcaatcatggcaacaaaagggagaa
aatcaagagaataattctggcgacattaactcccttcccatacctgaatggactctccat
attgaaggtagactactcgttaatcctgacgacgaagacgataaagcttttgaattagca
cctttcaccaactttttccgtaaaattgctatccaaattttacgatcagatgatctctat
cctagtggtaattatgttgaatggaataaacttccggataactctaatacatctaacggc
attaccgttacgagaaaaggcgaccaatccgtagatgtcaaaattatgttataccctgaa
gagcatcctgaacgatataaactttcaaaagcctttgctaatatactgggtattcgtgag
ggcactcgtcctgacatcgttagctacctttggcaatacatcaagttccatcgcttgcaa
gacatggaggagaaaagattaattaactgtgataaggcattaagggatttatttgaagca
gatcgtctttacttccctagaattcctgagcttatgaatagatttctcgaacctattgat
cccattgttataccgtataccattaatgtcagtgaacatactgttgaaaaagttacaatt
tttgatatccgtatcaacacggaagatcctaggcacagccaaattcgctctttccttgct
acgatgatgtcgcaagataaaatcagaagtattgacgataagcttaccgagttaattcaa
gctatcacttactcacagtcgaagtatgatttcatgaagaaattttcggagagtccaatt
gaatttattaacgaatggattgaatcccagagccgagatttagaaatcgttttggatggc
acaaatatgaattatgcagaaaaaagaagtgctgattattatcaacaaccctgggtacat
gagagtgcatttcattatcttaatttactaaatagcaaaaagcagcaaagcgttttaaat
gcttctgctaagaagtga

DBGET integrated database retrieval system