KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23H3.04
Entry
SPAC23H3.04       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DUF5389
Other DBs
NCBI-GeneID: 2541775
NCBI-ProteinID: NP_593794
PomBase: SPAC23H3.04
UniProt: O13938
Position
I:join(2499035..2499159,2499161..2499353,2499443..2499824,2499875..2500236)
AA seq 353 aa
MFWDFKHRIEQSVTNFRETTYEAFSRCKLFLKTLPKTSIFFLTVIILECLLIICFEGYCI
GQFRTVELLKNLGIDSLPISLTLFIFACFFILYLCVEALSSKNIIEIIGLLCIHVALFIY
SIVQISELAEIQKVFLSKTQSSLNPITLILNRHEAGNEGIYFILEVPKRIKPFLIALPVI
LGVASVMLGFLAHGMNKAYGWVIYKKIGPELRMRRRYLVYKIYVTLLKIDIYFFLGVTVQ
YVMVLPEDAVVEFVLTILVLPLTVLILTLSFNSVSSENMFLMMTVQFFYVCGIPYILFKI
IRMYTSTQKEYYASSKQMITTFSVITLLLLLFTIAIGFACSHNFKKGLKEYCM
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgttttgggattttaaacatcgaattgaacagtctgttacaaattttagagaaacaact
tatgaagcttttagccgatgtaaattattcttgaagacacttccaaaaacatcaattttt
tttttgacagtaattatactagaatgccttttgataatatgttttgaaggatattgtatc
ggacaattccgtactgtggaattgctaaagaatcttggaattgacagtttgcctatttca
ttaacgctatttatttttgcatgcttctttatattatatttatgcgtagaagctttaagt
tcaaaaaatataattgagatcatcggattgctatgcattcatgtcgcattatttatttat
tccattgttcaaatttcagaattagcagagattcagaaagtttttctttccaaaacacaa
tcctctcttaatcctataacgctaattttgaataggcatgaggcaggtaatgagggcatt
tactttatacttgaagtccccaagagaatcaaaccattcttaattgcgcttccggtaatc
cttggagtagcaagtgtaatgttagggttccttgcacatggaatgaacaaagcgtatgga
tgggtcatctacaaaaaaataggtcctgaactacgcatgcgaaggagatatttggtttat
aagatatacgtgactttgttaaagattgatatatacttttttttgggagtgacagtacaa
tatgtgatggttctaccggaggatgctgttgtcgaattcgtacttactattttggtatta
ccgcttacggtattgattttaactttatcattcaactctgtgtcttctgaaaatatgttt
ctcatgatgacagttcaatttttttacgtatgtggcataccgtatatccttttcaagata
attcggatgtatacttcaacacagaaagagtattatgcttcttcaaagcagatgattacc
actttttcggttatcactcttctccttttactgttcacaattgcaattggttttgcgtgt
tctcacaattttaaaaagggtctgaaagagtactgtatgtga

DBGET integrated database retrieval system