KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23H3.12cHelp
Entry
SPAC23H3.12c      CDS       T00076                                 

Definition
(RefSeq) putative hydrogen/potassium transport protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mit_KHE1
Motif
Other DBs
NCBI-GeneID: 2541865
NCBI-ProteinID: NP_593802
PomBase: SPAC23H3.12c
UniProt: O13942
Position
I:complement(2515193..2515873)
Genome map
AA seq 226 aa AA seqDB search
MRIIALPLPNQRVFLHCYPSEYLAKKVTIHDKIINRIYKYWDSWSASKSYTKQKVVSLGN
RILHATPYEENFLRAIAPVKKLNDTELHQTLYIEHPPNLESSTILAELNRSKQLQKTHTN
YLIGNIIGLPLTIPFILIPLIPNIPGFYLCYRAYCNFRAIQGSIQLARVMSIENIQMQES
EKLEKALKLFTNGDATPLNALIGHPDFVDRYKRAVAQEQRKSKIIK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagaattattgcacttcctttgccaaatcaaagggtattcttacattgttatccttct
gaataccttgccaaaaaagttactattcacgacaaaattataaacagaatttacaagtat
tgggactcctggagtgcttcaaaaagctataccaaacaaaaggttgtgtctttgggaaac
cgaattttgcatgcaactccttatgaagaaaattttttaagggcgattgctcctgttaag
aagctaaatgatacagaattacaccaaactttgtatattgaacatcctccaaatttggaa
tcaagtactattttagctgagttgaatcggtccaaacaattacaaaagacccatacaaat
taccttattggtaatattattggattaccattgactatacctttcattctcatacctcta
ataccaaatattccgggtttttatctttgttatagagcatactgcaattttcgtgctatt
caagggtctattcaattagctcgggtaatgagcatagaaaacattcaaatgcaggaaagt
gaaaaactagaaaaagcattgaagttgtttacaaatggagatgctacaccattaaacgct
ctcataggccacccggatttcgtggaccgctacaaacgtgccgttgctcaggagcaacgg
aaatcaaaaataatcaaataa

DBGET integrated database retrieval system