KEGG   Schizosaccharomyces pombe (fission yeast): SPAC23H4.18c
Entry
SPAC23H4.18c      CDS       T00076                                 
Symbol
rbx1
Name
(RefSeq) RING-box protein 1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03420  Nucleotide excision repair
spo04111  Cell cycle - yeast
spo04120  Ubiquitin mediated proteolysis
spo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPAC23H4.18c (rbx1)
   04120 Ubiquitin mediated proteolysis
    SPAC23H4.18c (rbx1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPAC23H4.18c (rbx1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPAC23H4.18c (rbx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:spo04121]
    SPAC23H4.18c (rbx1)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPAC23H4.18c (rbx1)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     SPAC23H4.18c (rbx1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   SPAC23H4.18c (rbx1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     SPAC23H4.18c (rbx1)
   Cul2 complex
     SPAC23H4.18c (rbx1)
   Cul3 complex
     SPAC23H4.18c (rbx1)
   Cul4 complex
     SPAC23H4.18c (rbx1)
   Cul7 complex
     SPAC23H4.18c (rbx1)
   Cul9 complex
     SPAC23H4.18c (rbx1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      SPAC23H4.18c (rbx1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      SPAC23H4.18c (rbx1)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 SCIFF zf-RING_UBOX
Other DBs
NCBI-GeneID: 2541897
NCBI-ProteinID: NP_593388
PomBase: SPAC23H4.18c
Ensembl: SPAC23H4.18c
UniProt: O13959
Position
I:1575290..1576307
AA seq 107 aa
MEDEMQIDKKEVEIEQKPPRFEIKKWNAVALWQWDIVVDNCAICRNHIMDLCIECQANTD
SAAAQECTVAWGTCNHAFHFHCISRWLNTRNVCPLDNREWEFQRYGH
NT seq 324 nt   +upstreamnt  +downstreamnt
atggaagatgaaatgcaaatagacaagaaggaggtggaaattgaacaaaaacctcctcga
tttgaaattaaaaagtggaatgctgtagcattatggcaatgggacattgttgtagataac
tgtgctatctgcagaaatcatattatggacttatgtattgagtgtcaagctaacaccgat
tctgctgctgctcaagagtgcacagtggcatggggaacttgtaatcatgcatttcacttt
cactgcatctcaagatggttaaacactaggaatgtttgtcctttggacaatcgtgaatgg
gagttccaacgttatggtcattaa

DBGET integrated database retrieval system