KEGG   Schizosaccharomyces pombe (fission yeast): SPAC24B11.13
Entry
SPAC24B11.13      CDS       T00076                                 

Gene name
hem3
Definition
(RefSeq) putative hydroxymethylbilane synthase
  KO
K01749  hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00860  Porphyrin and chlorophyll metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01240  Biosynthesis of cofactors
Module
spo_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPAC24B11.13 (hem3)
Enzymes [BR:spo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     SPAC24B11.13 (hem3)
SSDB
Motif
Pfam: Porphobil_deam Porphobil_deamC LRR_12
Other DBs
NCBI-GeneID: 3361383
NCBI-ProteinID: NP_001018179
PomBase: SPAC24B11.13
UniProt: Q09899
Position
I:231655..232665
AA seq 336 aa
MPSCTSFPIGTRKSKLAVIQSEIIREELEKHYPHLEFPIISRDTIGDEILSKALFEFKRQ
LAKSLWTRELEALLVTNQCRILVHSLKDLPSEMPDGMVIACIPKRSCPLDAIVFKAGSHY
KTVADLPPGSVVGTSSIRRRALLARNFPHLRFVDIRGNVGTRLAKLDAPDSQFDCLVLAA
AGLFRLGLKDRIAQMLTAPFVYYAVGQGALAVEVRADDKEMIEMLKPLQHQETLYACLAE
RALMKRLQGGCAIPIGVQTDVLAISNSSYRISLLGTVLSADGLRAAFGNAEAVVSSEEEA
EELGITVALALLKNGAGPILEEHQRSSDSEESLKNY
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgccatcctgtacttcattccccattggaactcgcaagtcaaaacttgctgtaattcaa
tcagaaattattcgtgaagagctcgaaaaacactacccccatcttgagtttccaatcatt
agcagagatactattggcgatgaaattctctcaaaggctttgtttgaatttaagcgtcaa
ctagcaaaatctttgtggacgcgagaacttgaagctttgctcgtcactaaccaatgtcgt
attctcgtacattctttgaaagatttgccctctgaaatgccagatggtatggtgatagcc
tgtatacccaaacgtagctgtcctttggatgccatcgtcttcaaggctggctcccactat
aaaactgtagccgatctccctcctggtagtgttgttggaaccagcagcattagacgtcgt
gctcttctcgctagaaatttccctcatcttcgtttcgttgacattcgtggaaacgttgga
accagacttgctaaacttgatgctcccgactctcaattcgattgtttagtccttgctgcc
gctggtctatttcgtttgggtttaaaagaccgtattgctcaaatgcttactgctcctttt
gtgtattatgccgttggacagggtgctttggctgttgaagttcgtgctgatgataaagag
atgattgagatgttgaagccgttgcagcatcaagaaactttatatgcttgtttggctgaa
cgtgctttgatgaagcgcttacaaggtggttgtgctatcccaatcggcgtacaaactgac
gttctcgctatttccaattcatcatatcgcatctcattacttggtacggtcctttctgct
gatggtcttagagccgcttttggcaatgctgaagctgtcgtttcgtcagaagaggaagcc
gaggaactgggaattacggttgcgctcgcacttctcaaaaatggcgctggtcccatttta
gaagagcatcaacggagcagtgatagtgaagaatctttaaaaaattattag

DBGET integrated database retrieval system