KEGG   Schizosaccharomyces pombe (fission yeast): SPAC24C9.02c
Entry
SPAC24C9.02c      CDS       T00076                                 

Definition
(RefSeq) putative cytochrome c1 heme lyase
  KO
K01764  cytochrome c heme-lyase [EC:4.4.1.17]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00860  Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPAC24C9.02c
Enzymes [BR:spo01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.17  holocytochrome-c synthase
     SPAC24C9.02c
SSDB
Motif
Pfam: Cyto_heme_lyase
Other DBs
NCBI-GeneID: 2541462
NCBI-ProteinID: NP_594026
PomBase: SPAC24C9.02c
UniProt: O13962
Position
I:complement(join(3039710..3039995,3040088..3040452))
AA seq 216 aa
MQPEQLNQEEESKCPVPPEVRDAWLKSHGGKKPSEVHDTPHPTMLPTEREISTIPKVVTE
SDSGKEEKWIYPSQQMFFDAMKRKNWNPHPEDMKTIVPIHNAVNERAWQDILQWEQGWGS
EKCGGPKLERFDGNVKKLTPKARILNLLGYNKPFDRHDWLVNRCGRKVAYVIDFYNGPTV
NGTPSIYLDVRPKLSVHGAWMRVYRWTNEHFSQNSK
NT seq 651 nt   +upstreamnt  +downstreamnt
atgcaacctgaacaactgaatcaagaagaagaatccaaatgtccagtgcctccggaagtt
cgtgatgcttggttaaaaagccatggcggaaagaagccgtctgaagttcacgatacccca
catcccacaatgcttcctactgaacgggaaatttcaacaattccaaaggtagtaacagaa
tcggattctggtaaagaagaaaaatggatttatccctcgcaacagatgttttttgatgcc
atgaaacgcaaaaattggaaccctcatcctgaagacatgaaaaccatagtaccaattcac
aatgctgtgaacgagagagcatggcaagacattcttcagtgggaacaaggatggggatct
gaaaaatgtggtggtccaaaacttgagagatttgatggtaatgtgaagaaattaacacca
aaagcaaggatcttaaacctcttgggatacaataaaccatttgacagacacgattggctt
gtaaatcgatgcggtcgcaaagtcgcgtacgttattgacttttataatggtccgactgtg
aacggaacaccaagtatttatcttgacgtccgaccaaaattaagtgtgcatggtgcttgg
atgcgtgtatatcgttggactaacgaacatttttcacaaaatagcaagtga

DBGET integrated database retrieval system