KEGG   Schizosaccharomyces pombe (fission yeast): SPAC24H6.04
Entry
SPAC24H6.04       CDS       T00076                                 

Gene name
hxk1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00010  Glycolysis / Gluconeogenesis
spo00051  Fructose and mannose metabolism
spo00052  Galactose metabolism
spo00500  Starch and sucrose metabolism
spo00520  Amino sugar and nucleotide sugar metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01200  Carbon metabolism
Module
spo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
spo_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPAC24H6.04 (hxk1)
   00051 Fructose and mannose metabolism
    SPAC24H6.04 (hxk1)
   00052 Galactose metabolism
    SPAC24H6.04 (hxk1)
   00500 Starch and sucrose metabolism
    SPAC24H6.04 (hxk1)
   00520 Amino sugar and nucleotide sugar metabolism
    SPAC24H6.04 (hxk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SPAC24H6.04 (hxk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPAC24H6.04 (hxk1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     SPAC24H6.04 (hxk1)
Membrane trafficking [BR:spo04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    SPAC24H6.04 (hxk1)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1 TFIIA_gamma_N
Other DBs
NCBI-GeneID: 2542634
NCBI-ProteinID: NP_592948
PomBase: SPAC24H6.04
UniProt: Q09756
Position
I:complement(483447..484901)
AA seq 484 aa
MSLHDAYHWPSRTPSRKGSNIKLNKTLQDHLDELEEQFTIPTELLHRVTDRFVSELYKGL
TTNPGDVPMVPTWIIGTPDGNEHGSYLALDLGGTNLRVCAVEVQGNGKFDITQSKYRLPQ
ELKVGTREALFDYIADCIKKFVEEVHPGKSQNLEIGFTFSYPCVQRSINDASLVAWTKGF
DIDGVEGESVGPLLSAALKRVGCNNVRLNAILSDTTGTLVASNYASPGTEIGVIFGTGCN
ACYIEKFSEIPKLHKYDFPEDMNMIINCEWCDFDNQHVVLPRTKYDVAIDEESPRPGLQT
YEKMIAGCYLGDILRRILLDLYEQGALFNGQDVTKIRDPLAMDTSVLSAIEVDPFENLDE
TQTLFEETYGLKTTEEERQFIRRACELIGTRSARLSACGVCALVRKMNKPSMIVGTDGSV
YNLYPRFKDRLAQAFKDILGEEIGSKVVTIPAEDGSGVGAALVSALEAKGKALTSDILAE
HLKN
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgtccttgcacgacgcttaccattggccttctcgtacacctagtcgtaagggttcaaat
atcaaattgaacaaaactttacaagatcatttggatgaactggaagaacaattcaccatt
cccactgaacttttacatcgcgttaccgatcgctttgtttctgagctttacaagggctta
accacgaacccgggtgatgttccaatggtccccacatggatcattggtactcctgatggc
aatgagcatggctcttatttggcattagatttaggtggtactaacttgcgtgtttgtgca
gttgaggttcaaggcaacggtaaattcgacattactcaaagcaaataccgtctacctcaa
gaactcaaagttggcactcgtgaggccctctttgattacattgccgactgtatcaagaaa
tttgtggaagaggttcacccaggtaaaagccaaaatttggaaattggtttcaccttttct
tacccctgtgttcaacgctccattaacgatgcttcattagttgcctggactaagggcttt
gatattgatggcgttgagggtgaaagtgtaggtcctcttttatcagcagccttgaagcgt
gttgggtgtaacaacgttagactcaatgccattttgagtgatactactggtacattggtt
gcttccaactatgccagcccaggtactgagattggtgtcatctttggaactggatgtaat
gcttgttacattgaaaagttctcagaaattcctaagcttcataagtatgacttccctgaa
gatatgaacatgatcatcaactgtgaatggtgcgattttgacaaccagcatgttgtcctt
cctcgtaccaaatacgatgttgctattgatgaagagtctcccagacccggtcttcaaacg
tacgagaaaatgattgctggatgctatttgggtgatatcttgcgtcgtattcttcttgac
ctttatgaacagggagctctctttaacggtcaggacgttaccaagattcgtgaccccttg
gccatggatacctctgtgctcagcgctattgaagttgacccctttgagaaccttgatgaa
actcaaaccctatttgaggaaacctatggtctcaagaccaccgaagaagagcgtcaattc
attcgtcgtgcatgcgaattgattggaactcgttctgcccgtctttctgcgtgtggtgta
tgcgcccttgttcgtaaaatgaataagccatctatgattgtaggtactgatggtagtgtc
tacaacttataccctcgttttaaggatcgtcttgctcaagcatttaaggatatccttggt
gaggaaattggcagcaaagttgttaccatccccgccgaagacggtagtggcgtaggtgct
gcattggtcagtgctcttgaagccaaaggcaaggccctcacttctgatattcttgccgag
catcttaagaattaa

DBGET integrated database retrieval system