KEGG   Schizosaccharomyces pombe (fission yeast): SPAC25A8.01c
Entry
SPAC25A8.01c      CDS       T00076                                 

Gene name
fft3
Definition
(RefSeq) putative protein Fft3
  KO
K14439  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 [EC:3.6.4.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC25A8.01c (fft3)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPAC25A8.01c (fft3)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    SPAC25A8.01c (fft3)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII
Other DBs
NCBI-GeneID: 2541531
NCBI-ProteinID: NP_593617
PomBase: SPAC25A8.01c
UniProt: O42861
Position
I:complement(2098281..2101049)
AA seq 922 aa
MDGKRKIEHTADGTHYDATSNVKRKPIFPPFIADSLSEATEKANVMGGGMNSRLQILSEM
SKRVQATAPISSLEHFKQLSDISPSFTSSANSINQPYNYSGSLENLVPTPSAGTPSQFMD
AQNPYGAVYNALSQFSETEPKMPSYMDDEEASDSLPLSLSSQSLSSQVTNQKPAPHRLTM
RERYAANNLTNGLQFTLPLSSRKTYEPEADDDSNDDMYSDDDSNADRWASRIDTAALKEE
VLKYMNRCSTQDLADMTGCTLAEAEFMVAKRPFPDLESALVVKQPRPVIPKGRRGRREKT
PLGPRLVGICMEIMRGYFVVDALIRQCEQLGGKIQRGIEAWGLSNTATSDEGETSLVNFD
QMKSFGTPANSSFITTPPASFSPDIKLQDYQIIGINWLYLLYELKLAGILADEMGLGKTC
QTIAFFSLLMDKNINGPHLVIAPASTMENWLREFAKFCPKLKIELYYGSQVEREEIRERI
NSNKDSYNVMLTTYRLAATSKADRLFLRNQKFNVCVYDEGHYLKNRASERYRHLMSIPAD
FRVLLTGTPLQNNLKELISLLAFILPHVFDYGLKSLDVIFTMKKSPESDFERALLSEQRV
SRAKMMMAPFVLRRKKSQVLDALPKKTRIIEFCEFSEEERRRYDDFASKQSVNSLLDENV
MKTNLDTNANLAKKKSTAGFVLVQLRKLADHPMLFRIHYKDDILRQMAKAIMNEPQYKKA
NELYIFEDMQYMSDIELHNLCCKFPSINSFQLKDEPWMDATKVRKLKKLLTNAVENGDRV
VLFSQFTQVLDILQLVMKSLNLKFLRFDGSTQVDFRQDLIDQFYADESINVFLLSTKAGG
FGINLACANMVILYDVSFNPFDDLQAEDRAHRVGQKKEVTVYKFVVKDTIEEHIQRLANA
KIALDATLSGNAETVEAEDDDD
NT seq 2769 nt   +upstreamnt  +downstreamnt
atggatggaaaaagaaaaatagagcataccgctgatggcacgcattacgacgcgacttcc
aacgtgaagcgcaagccaattttcccccctttcattgctgattcgctttcagaagctacc
gaaaaagctaatgttatggggggtggtatgaattcgcgacttcagattctttcagagatg
tctaaacgagttcaggctactgcacccatttcaagtttagaacatttcaagcagttgagt
gatatttctccctcatttacttcctctgctaactccataaatcaaccatataattattcc
ggttcgttagaaaatcttgttcctacaccttctgctggcactccttcgcaatttatggat
gcccaaaatccatacggcgctgtttacaatgctttatctcaattctctgagacagagccc
aaaatgccctcttacatggatgacgaagaagcaagcgattctttacctctttcattatcg
tctcaatcactgagttcacaggttacaaatcaaaagccagccccacatcgtcttacaatg
agagaacgatatgctgctaataatcttactaacggacttcaatttaccttgccattgtca
tctcgaaagacttatgagcctgaagctgacgatgacagcaatgatgatatgtactctgat
gatgattcaaatgcagatcgctgggcatctcgtatagatactgctgctctaaaggaggaa
gttcttaaatatatgaatcgttgttcaacacaggatttggctgacatgacaggttgtacg
cttgctgaagctgaatttatggttgccaaaagaccttttccagatcttgaatctgctttg
gtcgttaagcaacctcgtccggtgattcccaaaggtagacgaggtagacgtgaaaaaact
cctcttggaccacgtttagttggtatatgtatggaaattatgcgtggttatttcgtagtg
gatgcgcttattcgtcagtgtgagcagctaggtggtaaaattcagcgcggcattgaagcg
tggggcttgtcaaacactgctacatctgatgaaggtgaaacttctcttgtcaactttgat
caaatgaaaagtttcggtacgcctgcaaattcctcgtttatcactacacctcctgcatct
ttttcgcccgatatcaaactacaggattatcagatcattgggattaattggctttacctt
ttgtacgagctcaaactggctggtatcctggctgatgaaatggggctcggtaaaacttgt
caaaccatcgcttttttctcattactcatggataaaaatattaacgggccacatttggta
attgcacctgcttcaacgatggagaattggttacgtgaatttgccaagttctgtcccaag
ctaaaaattgaactttattatggatcgcaagtcgaacgtgaagaaattcgtgaacgtatc
aactctaataaagattcttataacgttatgttaaccacctaccgtttagccgctactagt
aaggctgatcgtttgtttttgcgcaaccaaaagttcaatgtttgtgtatatgacgaaggt
cattacttgaaaaaccgtgcgtctgagagatatcgtcatttgatgagtattcctgccgac
tttcgagttttgctaactggtacaccgctacagaataatcttaaagaattaatttcgctt
ttagcgttcattcttcctcatgtatttgattatggtttgaaaagtttagatgtcattttt
actatgaaaaaatccccagaaagcgactttgaacgagcattgctttcagaacagcgagta
tcgagagccaaaatgatgatggccccatttgtccttcgccgtaaaaagagccaggtgtta
gatgctttgccgaagaaaacgcgtattatagaattttgcgaattttccgaagaggaacgt
cgccgttatgatgacttcgctagcaaacaaagtgtaaattctttattggatgaaaatgtc
atgaaaactaatttagatacgaatgcaaatcttgcaaagaagaaaagcacagctggtttt
gtgcttgtacagcttcgtaagcttgcggatcaccctatgttgtttcgaattcattataaa
gatgatatccttcgacaaatggcgaaagctattatgaatgaaccccaatacaaaaaggca
aacgaactttatatatttgaagacatgcagtacatgtcagatattgagctacataatttg
tgttgcaaatttccgtctatcaattcattccaacttaaagatgaaccttggatggacgcc
acaaaggtcagaaaacttaaaaaactgctcactaatgctgttgaaaatggcgacagagtt
gtattatttagtcagtttacacaggttttggacattcttcaacttgtcatgaaatcatta
aatctaaagtttttaagatttgatggttctacacaagtcgatttccgccaggatctcatc
gatcaattttatgctgatgaaagcattaatgtatttcttctttctaccaaagccggcggt
tttggtatcaatcttgcgtgtgctaatatggttattctttatgatgtctctttcaatcca
ttcgatgaccttcaggcggaagatagagcacatagagttggccaaaagaaagaagttaca
gtttataaatttgttgtcaaggataccatcgaagagcacattcaacgtttagccaacgct
aaaattgctttggatgcgactctttccggcaatgccgaaactgtggaggctgaagatgac
gatgattag

DBGET integrated database retrieval system