KEGG   Schizosaccharomyces pombe (fission yeast): SPAC25B8.01
Entry
SPAC25B8.01       CDS       T00076                                 

Gene name
dap1
Definition
(RefSeq) cytochrome P450 regulator Dap1
  KO
K17278  membrane-associated progesterone receptor component
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPAC25B8.01 (dap1)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   SPAC25B8.01 (dap1)
SSDB
Motif
Pfam: Cyt-b5 VEFS-Box Syndecan
Other DBs
NCBI-GeneID: 2542688
NCBI-ProteinID: NP_594461
PomBase: SPAC25B8.01
UniProt: O13995
Position
I:4155473..4155973
AA seq 166 aa
MASTQVVFIVTLFLYLLITRWRRKNEKSFIASEEPKQPEWRDYTPAELKEYNGSKNSLVF
LAIKGTVYNVTMGSKFYGPQGPYSAFAGHDASRGLAKNSFDDEFIPDSDAEELDDCSDLN
DEERQALNDWKAFFDQKYQAVGRLISPREARAAATISETEEKVAHN
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcatctacacaagttgtttttatagtaaccttatttctttatttgctaatcactcgc
tggagaaggaagaatgagaaatcttttattgcaagcgaagagccaaaacagcccgaatgg
agagattatactccagcagaactgaaggaatataatggctccaaaaattcattggttttt
cttgctatcaagggaactgtgtacaacgttacaatgggatcaaaattttatggtccacaa
ggcccttatagtgcttttgccggtcatgatgccagtcgtggtttagcaaaaaatagtttt
gacgatgaatttattcctgattcagatgcagaagaattggatgattgcagtgatttaaac
gatgaggagaggcaggctctaaacgattggaaagcattttttgaccaaaaatatcaagct
gttggcaggctgataagtcccagagaggccagagcagcagctactatttcagaaaccgaa
gaaaaagttgcgcataattaa

DBGET integrated database retrieval system