KEGG   Schizosaccharomyces pombe (fission yeast): SPAC26F1.12c
Entry
SPAC26F1.12c      CDS       T00076                                 

Name
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DUF383 DUF384 HEAT_2 GlgS
Other DBs
NCBI-GeneID: 2542675
NCBI-ProteinID: NP_594883
PomBase: SPAC26F1.12c
UniProt: Q10498
Position
I:join(5153932..5153949,5153990..5154942,5154994..5155093)
AA seq 356 aa
MSELIELVGFLHDQNPQVRMLAVQHLLPYTARNHPQFSIWFHNDFEPVKDLKALLKDKPQ
IASQAVTALVNVSQNEKVRKVLMDDEFLQLIFSIVTNPLHGLADLSCMLLCNLAKEEDFA
RILDMQVPLREFSLSKNIIDQLMDLFVKGTDHGINEYANFDFLANVFADMTRFERGRKYF
TTLQEYDHVIPASKLVVFTEHKSLLRRTGVAAIIKNISFDIPFQKVLMDEEGINVLPYLL
LPLAGPEELSEEDMDGMFDELQLLPDDKKREPDHFIMKTLVETLVLLTATREGREHMRRR
KVYPIIRELHLNVDDEEIREVCDQLVQMLVRDEAPEELEHIQDNPPDEDDVIVEVD
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgtcagaacttatagaacttgtaggatttttacatgatcaaaatccgcaggtacggatg
ttagctgttcagcatttgcttccgtacaccgctaggaatcatcctcaatttagtatttgg
ttccacaatgactttgagccggtgaaagaccttaaggctctattgaaggacaagcctcag
attgcaagtcaagctgttacggctttagtgaatgtctcacaaaatgagaaagttcgtaaa
gtgttgatggatgatgaatttctgcagctcatttttagcattgtgacaaacccattgcat
ggattggctgatttgagctgtatgttgttgtgtaacttggccaaggaagaagactttgcc
cgtattttagatatgcaagttcctttaagagagttttcgttgagtaaaaatattattgat
cagttgatggatctttttgtgaaaggaaccgatcatggaatcaatgagtatgccaatttt
gattttttggccaacgtatttgctgatatgacacgttttgaaaggggaagaaaatacttt
acgactcttcaagagtatgatcatgtaattccagcatcgaaattggttgtttttacggag
cacaaatctttattgcgtcgcaccggtgtcgcagccatcattaaaaacatatcttttgac
atcccatttcagaaagttttgatggatgaagaaggtattaatgttttgccatatctttta
cttcctttggcaggtcctgaagaactcagtgaagaggatatggatggtatgtttgacgaa
ttacaactactaccagatgataagaaacgagagccggatcactttattatgaaaacttta
gttgaaacattggtactgcttactgctacacgggagggaagagaacatatgagacgccgt
aaggtgtaccctattatacgtgaattgcacttgaacgtggatgatgaagagattcgcgaa
gtttgtgatcagcttgtacaaatgttggtgcgtgacgaggcacctgaagaacttgagcac
atccaagataacccaccagatgaggatgatgttatcgttgaggtggattaa

DBGET integrated database retrieval system