KEGG   Schizosaccharomyces pombe (fission yeast): SPAC26F1.13c
Entry
SPAC26F1.13c      CDS       T00076                                 

Gene name
lrs1
Definition
(RefSeq) putative leucine--tRNA (Leu) ligase Lrs1
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPAC26F1.13c (lrs1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spo01007]
    SPAC26F1.13c (lrs1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPAC26F1.13c (lrs1)
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPAC26F1.13c (lrs1)
Enzymes [BR:spo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     SPAC26F1.13c (lrs1)
Amino acid related enzymes [BR:spo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SPAC26F1.13c (lrs1)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SPAC26F1.13c (lrs1)
 Prokaryotic type
    SPAC26F1.13c (lrs1)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPAC26F1.13c (lrs1)
SSDB
Motif
Pfam: tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1e
Other DBs
NCBI-GeneID: 2542670
NCBI-ProteinID: NP_594882
PomBase: SPAC26F1.13c
UniProt: Q10490
Position
I:5148944..5152279
AA seq 1111 aa
MATTEPSVEQLETKTAKLKLENTTKRDTLIELEKKYQQKWQEEKAFEVDAPLEDVPIDEL
RKKYPKFFGNMPYPYMNGALHLGHAFTLSKVEFTTAFERLNGKRVLFPMGFHCTGMPICA
SADRLSREIEMFGPSFDVPEEKEEEVEVEVKTPNAREDVTKHSGKKSKAAAKTAAVKYQF
QIMESLGVPRTEIHKFADAKYWLSYFPPLCQRDCTEFGLGIDWRRSFITTDVNPYYDSFV
RWQVNHLHDSGKIKFGERYTVYSIKDGQPCMDHDRKSGEGVGPQEYTGIKMEVLEFPEAA
RKALQSIDLSNKKVCMIAATLRPETMYGQTNCYVGPNITYGIYESNVPNELFICTRRAAN
NMAYQKLSKERGVVSELGTIKGQDLIGALVNAPLSVHKQVYVLPMETVLATKGTGVVTSV
PSDSPDDFATLTELRKKAEFYHLNPEWMKYEAVPIIRTPSYGDMCAEFLCKKLKIQSPKD
VKQLAQAKELAYKECFYQGTMIIGKYSGEKVETAKPKVRKELIDQGLAFVYNEPEGQVIS
RSGDDCIVALCDQWFLDYGEASWKAVTEKALDRLNTFSPEVRNGFLKTLDWLSQWACARS
YGLGTRLPWDPQFLVESLTDSTIYMAYYTICHLLHSDVYGKVPGALNIKPEQMTPEVWDH
VFRQAPKPKNTSISDEALARLCREFQYFYPFDIRASGKDLVPNHLTFCLYTHTAIFDEKY
WPKGIRANGHLLMNGEKMSKSTGNFMTLHEATKKFGADATRLALADAGDTVDDANFEEAL
ANSAILRLYTQEAWCKEMMENLDNLRTGPYNFHDKVFENEINQLIESSREAFSATLFKAA
LKSCFYDLQNARDWYREVTADRKMHRDLVCRWIETQVLLLATFAPHWSEHIWLTTLKKPQ
SIHVSGRFPQVSSPVNTALSNSLLYIRTLSRVIREAEAAQLKRQKKGKGMLFDPSKPKRL
TVFVAEKFPEWQAQYVALLQKYYNESENKFDDKAIISSVDKKEMKRAMPFIQQFKQSVIN
RGEHVSANSIFSRELGFNELEVLREVKPYLVRNVGIQELRIVLLQKPADKSSAAIGLVES
GSDAGATVEIAPNFANTVPGQPTFLFENVSA
NT seq 3336 nt   +upstreamnt  +downstreamnt
atggctacgactgaaccttccgtcgagcaactagagacgaagactgcaaagttgaagttg
gaaaacacgacgaagcgtgacactctaattgagttggagaaaaaatatcaacaaaaatgg
caagaagaaaaggcatttgaagtcgatgctcctttggaagatgttccgatcgatgaactt
cgtaagaaatatcctaaattttttggtaacatgccttatccttatatgaatggtgcattg
catcttggccatgccttcactttgtctaaggtcgagtttactacagcttttgaacgcttg
aatggaaagcgagtgttgtttcccatgggctttcactgcaccggtatgcctatttgcgct
agtgctgaccgtttgtcacgtgaaatagagatgtttggacccagctttgacgttcctgaa
gaaaaggaagaagaggtagaggtcgaagttaagactcctaatgctcgcgaagatgtcact
aagcacagcggtaaaaagagtaaggctgcggctaaaacagctgctgtaaagtaccaattt
caaattatggaatctcttggtgttccccggactgaaattcacaagtttgctgatgcaaag
tactggctctcatatttccctcccttgtgccaaagagattgtactgaatttggtctcggt
attgactggcgtcgttcctttatcactactgatgtcaatccttactatgactcctttgta
cgttggcaagtaaatcatttgcacgattctgggaaaattaagtttggtgagcgctatact
gtttattccatcaaggacggtcaaccctgtatggatcacgaccgtaaaagtggtgaaggt
gttggtcctcaggagtacactggtatcaaaatggaagttttggagttccccgaggctgct
cgtaaagctctccaatccattgatctttccaataagaaggtctgtatgattgcagcaacg
ctccgtccagaaaccatgtatggccaaacaaattgctatgttggccccaacatcacctat
ggcatttacgaaagtaatgttcccaatgagcttttcatttgcactcgtcgtgctgctaac
aacatggcataccaaaagctttcaaaggaacgtggtgtagtcagcgaacttggaaccatt
aagggacaagaccttattggcgcccttgttaatgcacctctgtccgtgcacaaacaagtt
tatgttttacctatggaaacagttttggctactaagggtactggcgtggtcacctctgtg
cctagcgactctcctgatgactttgctactttaactgagcttcgcaaaaaggctgaattt
tatcacttgaatcccgagtggatgaagtacgaagctgtccctattattcgcactccttct
tatggtgacatgtgtgctgagtttttgtgcaaaaaacttaagattcaaagtcctaaggat
gttaaacaattggctcaagctaaggagcttgcttataaagagtgtttctaccaaggtacg
atgattatcggtaaatattccggtgagaaggtcgagacagccaagcccaaggttcgtaag
gagttgattgatcaaggccttgcttttgtttataatgaacccgaaggacaagttattagt
cgcagtggtgatgattgtattgttgccttgtgcgaccaatggtttttggattatggcgag
gcttcttggaaggccgtaaccgagaaggcattggatcgtttgaacactttctcacccgag
gtccgtaatggttttttgaaaaccttggattggcttagccaatgggcttgtgctcgttct
tatggtttaggtactcgcttgccatgggatcctcagttccttgttgaaagtttgaccgac
tcgaccatctacatggcctattatacaatttgccatcttttgcatagcgatgtatatggt
aaggtaccgggtgctttgaacattaagcctgagcaaatgactcctgaagtatgggatcat
gttttccgccaagcaccaaagcctaaaaacaccagcatatccgatgaagcattggctcgt
ctttgccgtgagttccaatacttttatccttttgatattcgtgcttccggtaaagatttg
gttcctaatcatcttaccttctgtttgtacacccataccgccatttttgatgagaagtat
tggcccaaaggtatacgcgccaatggccatcttctcatgaatggtgaaaagatgtctaaa
tccactggtaactttatgactcttcatgaggccaccaagaaattcggtgcagacgcaact
cgtttagctcttgctgatgctggtgatactgttgatgatgcaaactttgaagaggctttg
gccaattctgctattcttcgtctgtatacccaggaagcctggtgtaaggagatgatggaa
aaccttgacaatttacgcacaggcccttacaacttccatgataaagtttttgaaaacgag
atcaatcaactcatcgaatcatctagagaagctttttctgctactcttttcaaggctgcc
ttgaagagttgcttttacgatcttcaaaatgctcgtgattggtatcgtgaggtaaccgct
gatcgtaaaatgcatcgcgatcttgtttgtcgttggatagaaactcaagtgcttctgctg
gctacatttgcacctcactggtcagaacacatctggcttacaactctcaagaaacctcag
agtatccatgtttctggtcgtttcccccaagtttccagccctgtaaacacggctttatct
aactccttgttatacatccgtacactgagccgtgtaattcgtgaagccgaggcagctcaa
ctcaagcgtcaaaagaaaggtaaaggtatgcttttcgatccctccaagcctaagcgtctt
actgtgttcgtcgctgaaaagttccccgagtggcaagctcagtacgttgctcttcttcaa
aaatactataatgagtctgagaataagtttgatgataaagcaatcatttctagtgttgat
aaaaaggaaatgaagcgcgcaatgcccttcattcagcaattcaaacaatctgtcattaac
cgtggagagcatgtgtcagccaattccatatttagtcgtgaactcggattcaatgagctt
gaagttttgcgtgaggttaagccttaccttgttcgaaacgttggtattcaagagcttcgc
attgtccttcttcaaaaacctgcagataaatcttcagctgctattggtttggttgaaagt
ggatcggatgccggtgctactgtagagattgcacctaattttgcaaataccgtacccggt
cagcctacatttttgtttgaaaatgtctctgcttaa

DBGET integrated database retrieval system