KEGG   Schizosaccharomyces pombe (fission yeast): SPAC26H5.03
Entry
SPAC26H5.03       CDS       T00076                                 

Gene name
pcf2
Definition
(RefSeq) CAF assembly factor complex subunit B Pcf2
  KO
K10751  chromatin assembly factor 1 subunit B
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPAC26H5.03 (pcf2)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    CAF-1
     SPAC26H5.03 (pcf2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A
Other DBs
NCBI-GeneID: 2542071
NCBI-ProteinID: NP_594450
PomBase: SPAC26H5.03
UniProt: O13985
Structure
PDB: 
2Z3F

Position
I:join(4119899..4120030,4120126..4120228,4120270..4120512,4120578..4121638)
AA seq 512 aa
MRAEVLQIRWHYDANDDHTPIYSVDFQKNSLNKFATCGGDSKIRIWQLITSESSTKVEYL
STLSRHTQAVNVVRFNPEGNILATAGDEGTIMLWVPTNTPITTLADDAEELALAKEYWKV
KIVCRSMGSEIYDLCWSVDSNFLIAGAMDNSLRLYDAHTGQLLTQKFDHSHYVQGVCWDP
LNQYIVSESSDRSICLYEIQEEKKNPKKFQLVLKSRICRIEYNVTKFELISVTKPLNNDE
SSGISEPIETSNNNESPVSKHEALSSTANIVKDGSLERTEPPNSLNSKISYSLYCNETLV
SFFRRPAFSPDGLLLVTPAGRLRPHGQPNFEVPYTAYIYTRGSITKQPVACLNGFKKPVI
AVRFSPIHYELNSFSNFSFTSVSFNLPYRMVFAVACQDAVYIYDTQTCKPFYRAVNLHYS
NLTDIAWNDDGNVLLMTSIDGFCSVITFEPGELGVKSQHKISLPEKRSASPSSIDDSQDN
TAGGPATTTLIPRKVESSKVSKKRIAPTPVYP
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgagagcggaggttttgcagatacgatggcattatgatgctaatgatgatcacacacct
atttattcagttgattttcaaaagaacagtcttaataaatttgctacatgtggaggagac
agtaaaatcaggatatggcaattgatcacttcggaatcatccacaaaagtcgaatatttg
tctacgttaagtcgacacacgcaagcagtgaacgtcgttcgtttcaatccagaaggaaat
attcttgctaccgccggagatgaaggaactattatgttatgggttccaactaacactcct
ataacaactttggctgatgatgcggaagagttggctctagctaaagaatattggaaggtc
aaaatagtttgtaggtcgatgggttcagaaatatatgatttatgctggtcggttgacagt
aattttcttattgccggcgccatggataatagtcttcggttgtacgatgctcacacaggg
caactgcttactcaaaaattcgaccattcacattacgttcaaggggtatgttgggatcct
ttgaatcaatacatcgtttcggaaagtagtgatcgttctatatgtttatacgaaattcaa
gaggaaaaaaagaatccgaaaaaattccaactcgttttaaaatcgcgcatctgtcgtatt
gagtataatgtaactaaattcgaattaatatctgttacgaagcccttaaataatgatgaa
tcatcggggatatcagaacctatcgaaacttctaataataatgagtctcccgtatctaag
cacgaagctctctcatcaactgcaaacatagtcaaagatggaagcttagagcgaacagag
cctccaaattctctcaattcaaaaatcagttactctttgtactgcaatgaaactcttgtt
tctttttttcgtcgtccagcattctcccctgacggattactactagttacgcctgctggt
cggcttcgaccgcacggtcaaccaaactttgaagttccctatactgcttatatttataca
agagggagtataaccaaacagccagtagcttgtcttaatggattcaaaaaaccagttatt
gcggttcgtttttctccaattcattatgaattgaactcattctctaacttctcttttact
tctgtctcttttaatcttccttatcgaatggtatttgctgtggcatgtcaagatgctgtt
tatatttatgatacgcaaacttgcaaaccattttatcgtgcagtaaatttacattactct
aaccttacagacatagcttggaatgatgatggaaatgttttgttaatgacttctatagat
ggtttttgttctgtaattacctttgaacctggagaattgggtgtcaaaagtcaacacaaa
atttctttgccggagaaacgatcagcttcaccctctagtattgatgattcacaagacaat
acggctgggggaccagctactacaacactaattcccagaaaagttgaatcttcaaaagta
tcaaagaagcgtattgcacctacccccgtttatccataa

DBGET integrated database retrieval system